StarFunc result for job id O00512

User Input

>input (1426 residues)
MHSSNPKVRSSPSGNTQSSPKSKQEVMVRPPTVMSPSGNPQLDSKFSNQGKQGGSASQSQ
PSPCDSKSGGHTPKALPGPGGSMGLKNGAGNGAKGKGKRERSISADSFDQRDPGTPNDDS
DIKECNSADHIKSQDSQHTPHSMTPSNATAPRSSTPSHGQTTATEPTPAQKTPAKVVYVF
STEMANKAAEAVLKGQVETIVSFHIQNISNNKTERSTAPLNTQISALRNDPKPLPQQPPA
PANQDQNSSQNTRLQPTPPIPAPAPKPAAPPRPLDRESPGVENKLIPSVGSPASSTPLPP
DGTGPNSTPNNRAVTPVSQGSNSSSADPKAPPPPPVSSGEPPTLGENPDGLSQEQLEHRE
RSLQTLRDIQRMLFPDEKEFTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGP
GPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFY
EEKRRKQEQVVVQQCSLQDMMVHQHGPRGVVRGPPPPYQMTPSEGWAPGGTEPFSDGINM
PHSLPPRGMAPHPNMPGSQMRLPGFAGMINSEMEGPNVPNPASRPGLSGVSWPDDVPKIP
DGRNFPPGQGIFSGPGRGERFPNPQGLSEEMFQQQLAEKQLGLPPGMAMEGIRPSMEMNR
MIPGSQRHMEPGNNPIFPRIPVEGPLSPSRGDFPKGIPPQMGPGRELEFGMVPSGMKGDV
NLNVNMGSNSQMIPQKMREAGAGPEEMLKLRPGGSDMLPAQQKMVPLPFGEHPQQEYGMG
PRPFLPMSQGPGSNSGLRNLREPIGPDQRTNSRLSHMPPLPLNPSSNPTSLNTAPPVQRG
LGRKPLDISVAGSQVHSPGINPLKSPTMHQVQSPMLGSPSGNLKSPQTPSQLAGMLAGPA
AAASIKSPPVLGSAAASPVHLKSPSLPAPSPGWTSSPKPPLQSPGIPPNHKAPLTMASPA
MLGNVESGGPPPPTASQPASVNIPGSLPSSTPYTMPPEPTLSQNPLSIMMSRMSKFAMPS
STPLYHDAIKTVASSDDDSPPARSPNLPSMNNMPGMGINTQNPRISGPNPVVPMPTLSPM
GMTQPLSHSNQMPSPNAVGPNIPPHGVPMGPGLMSHNPIMGHGSQEPPMVPQGRMGFPQG
FPPVQSPPQQVPFPHNGPSGGQGSFPGGMGFPGEGPLGRPSNLPQSSADAALCKPGGPGG
PDSFTVLGNSMPSVFTDPDLQEVIRPGATGIPEFDLSRIIPSEKPSQTLQYFPRGEVPGR
KQPQGPGPGFSHMQGMMGEQAPRMGLALPGMGGPGPVGTPDIPLGTAPSMPGHNPMRPPA
FLQQGMMGPHHRMMSPAQSTMPGQPTLMSNPAAAVGMIPGKDRGPAGLYTHPGPVGSPGM
MMSMQGMMGPQQNIMIPPQMRPRGMAADVGMGGFSQGPGNPGNMMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00512	0.999	0.999	0.000	1426	1.000	1.000	O00512.pdb.gz	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4
2	AFDB:F1R405	0.089	0.083	2.038E-87	1573	0.600	0.544	F1R405.pdb.gz	F1R405_DANRE B-cell CLL/lymphoma 9 protein isoform X1 OS=Danio rerio OX=7955 GN=si:ch73-15j19.1 PE=1 SV=1
3	AFDB:Q86UU0	0.066	0.063	6.649E-44	1499	0.365	0.348	Q86UU0.pdb.gz	BCL9L_HUMAN B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1
4	AFDB:Q67FY3	0.052	0.049	1.133E-26	1530	0.320	0.299	Q67FY3.pdb.gz	BCL9L_DANRE B-cell CLL/lymphoma 9-like protein OS=Danio rerio OX=7955 GN=bcl9l PE=2 SV=1
5	AFDB:Q6XZL8	0.034	0.028	1.536E-6	1540	0.147	0.136	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
6	AFDB:Q9VVC6	0.035	0.030	3.203E-6	2029	0.151	0.106	Q9VVC6.pdb.gz	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3
7	AFDB:Q9NZ56	0.034	0.030	1.392E-5	1722	0.183	0.152	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
8	AFDB:Q961D9	0.049	0.048	2.079E-5	1469	0.194	0.189	Q961D9.pdb.gz	BCL9_DROME Protein BCL9 homolog OS=Drosophila melanogaster OX=7227 GN=lgs PE=1 SV=1
9	AFDB:Q9Z1Q1	0.042	0.040	3.103E-5	1818	0.154	0.121	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
10	AFDB:F4I1T7	0.034	0.030	5.661E-5	1819	0.173	0.135	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
11	PDB:3j4qB	0.026	0.086	1.375	382	0.010	0.037	3j4qB.pdb.gz
12	PDB:4rtaB	0.023	0.291	4.281	71	0.003	0.056	4rtaB.pdb.gz
13	PDB:7myjC	0.024	0.057	5.979	465	0.009	0.028	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
14	PDB:5x3tA	0.030	0.427	7.305	70	0.004	0.086	5x3tA.pdb.gz
15	PDB:7dvqR	0.026	0.109	7.305	241	0.015	0.087	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:7pxcE	0.023	0.063	7.810	483	0.005	0.014	7pxcE.pdb.gz	Structural basis of prokaryotic ubiquitin-like protein engagement and translocation by the mycobacterial Mpa-proteasome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R405	0.0	1141	1573	0.590	0.535	F1R405_DANRE B-cell CLL/lymphoma 9 protein isoform X1 OS=Danio rerio OX=7955 GN=si:ch73-15j19.1 PE=1 SV=1
2	O00512	0.0	2777	1426	1.000	1.000	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4
3	Q67FY0	0.0	1127	1474	0.590	0.571	Q67FY0_DANRE B-cell CLL/lymphoma 9 protein OS=Danio rerio OX=7955 GN=si:ch73-15j19.1 PE=1 SV=1
4	Q9D219	0.0	2501	1425	0.953	0.954	BCL9_MOUSE B-cell CLL/lymphoma 9 protein OS=Mus musculus OX=10090 GN=Bcl9 PE=1 SV=3
5	A0A087WZX0	8.47e-112	388	1462	0.316	0.308	A0A087WZX0_HUMAN BCL9 like OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1
6	Q67FY2	9.41e-112	389	1494	0.318	0.304	BCL9L_MOUSE B-cell CLL/lymphoma 9-like protein OS=Mus musculus OX=10090 GN=Bcl9l PE=1 SV=1
7	Q86UU0	2.60e-111	387	1499	0.316	0.300	BCL9L_HUMAN B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1
8	Q67FY3	1.62e-45	182	1530	0.157	0.146	BCL9L_DANRE B-cell CLL/lymphoma 9-like protein OS=Danio rerio OX=7955 GN=bcl9l PE=2 SV=1
9	Q8TB24	4.6	34.3	985	0.020	0.029	RIN3_HUMAN Ras and Rab interactor 3 OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=4
10	A0A1D8PD52	6.8	33.5	1287	0.020	0.023	A0A1D8PD52_CANAL Msb1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSB1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11502 BCL9	1.1e-14	65.2	B-cell lymphoma 9 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234739

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302327	0.999	Pygopus homolog 1
2	9606.ENSP00000344456	0.999	Catenin beta-1
3	9606.ENSP00000357442	0.996	Pygopus homolog 2
4	9606.ENSP00000358404	0.987	Transcription factor 7-like 2
5	9606.ENSP00000355657	0.980	Histone H3.1t
6	9606.ENSP00000381382	0.925	Transcription factor 4
7	9606.ENSP00000335320	0.922	B-cell CLL/lymphoma 9-like protein
8	9606.ENSP00000365682	0.919	Transducin-like enhancer protein 1
9	9606.ENSP00000452871	0.907	Transducin-like enhancer protein 3
10	9606.ENSP00000358151	0.906	Histone H2B type 2-E
11	9606.ENSP00000332194	0.901	Histone H2A type 2-C
12	9606.ENSP00000274764	0.900	Histone H2B type 1-A
13	9606.ENSP00000289316	0.900	Histone H2B type 1-D
14	9606.ENSP00000296417	0.900	Histone H2A.Z
15	9606.ENSP00000308405	0.900	Histone H2A.V
16	9606.ENSP00000328484	0.900	Histone H2A type 1-J
17	9606.ENSP00000341094	0.900	Histone H2A type 1-D
18	9606.ENSP00000349430	0.900	Histone H2B type 1-K
19	9606.ENSP00000365720	0.900	Transducin-like enhancer protein 4
20	9606.ENSP00000366618	0.900	Histone H2B type 1-L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008013	0.567	beta-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0048856	0.941	anatomical structure development
GO:0009987	0.937	cellular process
GO:0010468	0.936	regulation of gene expression
GO:0019219	0.936	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.934	regulation of biosynthetic process
GO:0051252	0.934	regulation of RNA metabolic process
GO:0048518	0.929	positive regulation of biological process
GO:0048513	0.909	animal organ development
GO:0031326	0.875	regulation of cellular biosynthetic process
GO:0048522	0.869	positive regulation of cellular process
GO:2001141	0.850	regulation of RNA biosynthetic process
GO:0006355	0.840	regulation of DNA-templated transcription
GO:0009893	0.726	positive regulation of metabolic process
GO:0010604	0.718	positive regulation of macromolecule metabolic process
GO:0051173	0.696	positive regulation of nitrogen compound metabolic process
GO:0050896	0.689	response to stimulus
GO:0031325	0.683	positive regulation of cellular metabolic process
GO:0032501	0.677	multicellular organismal process
GO:0051716	0.645	cellular response to stimulus
GO:0007154	0.626	cell communication
GO:0071704	0.615	organic substance metabolic process
GO:0048583	0.588	regulation of response to stimulus
GO:0010646	0.569	regulation of cell communication
GO:0023052	0.566	signaling
GO:0009966	0.562	regulation of signal transduction
GO:0044238	0.550	primary metabolic process
GO:0045935	0.508	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.494	positive regulation of RNA metabolic process
GO:0007165	0.484	signal transduction
GO:0006357	0.472	regulation of transcription by RNA polymerase II
GO:0045893	0.465	positive regulation of DNA-templated transcription
GO:0006807	0.434	nitrogen compound metabolic process
GO:0044237	0.420	cellular metabolic process
GO:0043170	0.372	macromolecule metabolic process
GO:0045944	0.361	positive regulation of transcription by RNA polymerase II
GO:0198738	0.359	cell-cell signaling by wnt
GO:0016055	0.340	Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005801	0.995	cis-Golgi network
GO:0031974	0.984	membrane-enclosed lumen
GO:0070013	0.969	intracellular organelle lumen
GO:0032991	0.962	protein-containing complex
GO:0005654	0.947	nucleoplasm
GO:0140513	0.786	nuclear protein-containing complex
GO:1990907	0.682	beta-catenin-TCF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]