StarFunc result for job id O00519

User Input

>input (579 residues)
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00519	1.000	1.000	0.000	579	1.000	1.000	O00519.pdb.gz	FAAH1_HUMAN Fatty-acid amide hydrolase 1 OS=Homo sapiens OX=9606 GN=FAAH PE=1 SV=2
2	AFDB:O08914	0.955	0.955	6.549E-96	579	0.839	0.839	O08914.pdb.gz	FAAH1_MOUSE Fatty-acid amide hydrolase 1 OS=Mus musculus OX=10090 GN=Faah PE=1 SV=1
3	PDB:3qj9A	0.936	0.988	1.251E-90	549	0.791	0.834	3qj9A.pdb.gz	Discovery and molecular basis of potent noncovalent inhibitors of fatty acid amide hydrolase (FAAH).
4	AFDB:Q17449	0.906	0.917	7.341E-54	572	0.368	0.372	Q17449.pdb.gz	FAAH1_CAEEL Fatty acid amide hydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=faah-1 PE=1 SV=1
5	AFDB:F1N9Z0	0.728	0.905	2.600E-47	464	0.399	0.498	F1N9Z0.pdb.gz
6	AFDB:P08158	0.772	0.815	5.714E-36	548	0.263	0.277	P08158.pdb.gz	AMDS_EMENI Acetamidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=amdS PE=2 SV=1
7	AFDB:O59805	0.766	0.831	1.476E-35	533	0.254	0.276	O59805.pdb.gz	YJV7_SCHPO Putative amidase C550.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.07 PE=3 SV=1
8	AFDB:Q8TFF9	0.790	0.835	3.262E-34	547	0.230	0.243	Q8TFF9.pdb.gz	YP23_SCHPO Putative amidase PB8B6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPB8B6.03 PE=3 SV=1
9	AFDB:G5EAW7	0.772	0.796	1.676E-31	561	0.235	0.242	G5EAW7.pdb.gz	G5EAW7_EMENI amidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03957 PE=3 SV=1
10	AFDB:Q7K2E1	0.639	0.696	5.197E-28	529	0.226	0.248	Q7K2E1.pdb.gz	Q7K2E1_DROME LD05247p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8839 PE=1 SV=1
11	AFDB:Q6GMR7	0.626	0.679	3.830E-27	532	0.207	0.226	Q6GMR7.pdb.gz	FAAH2_HUMAN Fatty-acid amide hydrolase 2 OS=Homo sapiens OX=9606 GN=FAAH2 PE=1 SV=1
12	PDB:6c6gA	0.625	0.782	3.538E-26	457	0.211	0.267	6c6gA.pdb.gz	An unexpected vestigial protein complex reveals the evolutionary origins of ans-triazine catabolic enzyme.
13	PDB:6diiH	0.601	0.568	1.091E-21	616	0.188	0.177	6diiH.pdb.gz	Structural analysis of a plant fatty acid amide hydrolase provides insights into the evolutionary diversity of bioactive acylethanolamides.
14	PDB:4n0iA	0.549	0.691	1.530E-19	450	0.159	0.204	4n0iA.pdb.gz	Crystal structure of Saccharomyces cerevisiae mitochondrial GatFAB reveals a novel subunit assembly in tRNA-dependent amidotransferases
15	PDB:4il8A	0.085	0.101	4.362E-1	459	0.079	0.100	4il8A.pdb.gz	Identification of an essential active-site residue in the alpha-D-phosphohexomutase enzyme superfamily.
16	PDB:5f55A	0.086	0.075	7.555E-1	705	0.088	0.072	5f55A.pdb.gz	Structural basis for DNA 5 -end resection by RecJ
17	PDB:4eswA	0.101	0.146	8.348E-1	342	0.076	0.129	4eswA.pdb.gz
18	PDB:2vk2A	0.060	0.099	9.698E-1	296	0.059	0.115	2vk2A.pdb.gz	Furanose-Specific Sugar Transport: Characterization of a Bacterial Galactofuranose-Binding Protein.
19	PDB:3nu7B	0.120	0.169	1.245	359	0.078	0.125	3nu7B.pdb.gz	Structural Analysis of WbpE from Pseudomonas aeruginosa PAO1: A Nucleotide Sugar Aminotransferase Involved in O-Antigen Assembly
20	PDB:2dlcX	0.101	0.154	2.266	339	0.052	0.088	2dlcX.pdb.gz	Structural basis for recognition of cognate tRNA by tyrosyl-tRNA synthetase from three kingdoms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00519	0.0	1186	579	1.000	1.000	FAAH1_HUMAN Fatty-acid amide hydrolase 1 OS=Homo sapiens OX=9606 GN=FAAH PE=1 SV=2
2	O08914	0.0	954	579	0.839	0.839	FAAH1_MOUSE Fatty-acid amide hydrolase 1 OS=Mus musculus OX=10090 GN=Faah PE=1 SV=1
3	P97612	0.0	905	579	0.827	0.827	FAAH1_RAT Fatty-acid amide hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Faah PE=1 SV=1
4	Q90578	4.36e-149	439	464	0.392	0.489	VDHAP_CHICK Vitamin D3 hydroxylase-associated protein OS=Gallus gallus OX=9031 PE=1 SV=3
5	Q17449	6.18e-120	368	572	0.373	0.378	FAAH1_CAEEL Fatty acid amide hydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=faah-1 PE=1 SV=1
6	O59805	1.41e-52	190	533	0.242	0.263	YJV7_SCHPO Putative amidase C550.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.07 PE=3 SV=1
7	P08158	1.61e-46	173	548	0.268	0.283	AMDS_EMENI Acetamidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=amdS PE=2 SV=1
8	Q8TFF9	1.17e-40	157	547	0.223	0.236	YP23_SCHPO Putative amidase PB8B6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPB8B6.03 PE=3 SV=1
9	G5EAW7	3.24e-31	130	561	0.230	0.237	G5EAW7_EMENI amidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03957 PE=3 SV=1
10	Q7K2E1	1.18e-30	128	529	0.238	0.261	Q7K2E1_DROME LD05247p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8839 PE=1 SV=1
11	Q6GMR7	1.33e-28	122	532	0.142	0.154	FAAH2_HUMAN Fatty-acid amide hydrolase 2 OS=Homo sapiens OX=9606 GN=FAAH2 PE=1 SV=1
12	O06491	1.81e-18	90.9	485	0.124	0.148	GATA_BACSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus subtilis (strain 168) OX=224308 GN=gatA PE=1 SV=3
13	Q936X3	2.18e-18	90.5	457	0.124	0.158	ATZE_PSESD 1-carboxybiuret hydrolase subunit AtzE OS=Pseudomonas sp. (strain ADP) OX=47660 GN=atzE PE=1 SV=1
14	K9NBS6	1.73e-17	87.8	477	0.123	0.149	AAM_RHOER Acylamidase OS=Rhodococcus erythropolis OX=1833 GN=aam PE=1 SV=1
15	P9WQ93	3.04e-17	87.0	475	0.128	0.156	AMI4_MYCTU Putative amidase AmiD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=amiD PE=1 SV=1
16	Q7XJJ7	2.19e-15	81.6	607	0.107	0.102	FAAH_ARATH Fatty acid amide hydrolase OS=Arabidopsis thaliana OX=3702 GN=FAAH PE=1 SV=1
17	E0SI86	5.59e-15	79.7	446	0.100	0.130	E0SI86_DICD3 Indoleacetamide hydrolase OS=Dickeya dadantii (strain 3937) OX=198628 GN=iaaH PE=4 SV=1
18	G7ISB0	9.12e-15	79.7	607	0.111	0.105	FAAH_MEDTR Fatty acid amide hydrolase OS=Medicago truncatula OX=3880 GN=FAAH PE=1 SV=1
19	Q72DX1	3.62e-14	77.4	489	0.109	0.129	GATA_DESVH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=gatA PE=1 SV=1
20	Q0JFH7	2.16e-13	75.5	608	0.098	0.094	FAAH_ORYSJ Fatty acid amide hydrolase OS=Oryza sativa subsp. japonica OX=39947 GN=FAAH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01425 Amidase	2.6e-122	420.7	Amidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407112	0.965	N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
2	9606.ENSP00000358513	0.959	Cannabinoid receptor 1
3	9606.ENSP00000265052	0.924	Monoglyceride lipase
4	9606.ENSP00000459962	0.909	Transient receptor potential cation channel, subfamily V, member 1
5	9606.ENSP00000461007	0.893	Transient receptor potential cation channel subfamily V member 1
6	9606.ENSP00000257215	0.886	Sn1-specific diacylglycerol lipase alpha
7	9606.ENSP00000420315	0.857	Monoacylglycerol lipase ABHD6
8	9606.ENSP00000263985	0.856	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
9	9606.ENSP00000286733	0.845	N-acylethanolamine-hydrolyzing acid amidase
10	9606.ENSP00000375894	0.832	G-protein coupled receptor 55
11	9606.ENSP00000365725	0.823	Monoacylglycerol lipase ABHD12
12	9606.ENSP00000297258	0.820	Fatty acid-binding protein, epidermal
13	9606.ENSP00000297056	0.815	Sn1-specific diacylglycerol lipase beta
14	9606.ENSP00000363596	0.807	Cannabinoid receptor 2
15	9606.ENSP00000357429	0.768	Fatty acid-binding protein, brain
16	9606.ENSP00000362817	0.767	Fatty acid-binding protein, heart
17	9606.ENSP00000414558	0.751	Protein ABHD4
18	9606.ENSP00000352257	0.721	X-ray repair cross-complementing protein 6
19	9606.ENSP00000343428	0.715	N-arachidonyl glycine receptor
20	9606.ENSP00000276218	0.675	Glucose-dependent insulinotropic receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016811	1.000	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0016788	0.711	hydrolase activity, acting on ester bonds
GO:0016298	0.634	lipase activity
GO:0017064	0.608	fatty acid amide hydrolase activity
GO:0052689	0.576	carboxylic ester hydrolase activity
GO:0047372	0.548	acylglycerol lipase activity
GO:0042802	0.308	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0032787	0.995	monocarboxylic acid metabolic process
GO:0006631	0.992	fatty acid metabolic process
GO:0044242	0.969	cellular lipid catabolic process
GO:0009062	0.952	fatty acid catabolic process
GO:0001676	0.922	long-chain fatty acid metabolic process
GO:0120254	0.920	olefinic compound metabolic process
GO:0033559	0.874	unsaturated fatty acid metabolic process
GO:0006690	0.870	icosanoid metabolic process
GO:0019369	0.859	arachidonic acid metabolic process
GO:0065007	0.599	biological regulation
GO:0050789	0.564	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031090	0.988	organelle membrane
GO:0012505	0.984	endomembrane system
GO:0005783	0.872	endoplasmic reticulum
GO:0031984	0.683	organelle subcompartment
GO:0042175	0.677	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.671	endoplasmic reticulum membrane
GO:0043232	0.336	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	1.000	In linear amides.
EC:3.1.-.-	0.711	Acting on ester bonds.
EC:3.5.1.99	0.608	fatty acid amide hydrolase.
EC:3.1.1.-	0.576	Carboxylic ester hydrolases.
RHEA:34019	0.548	a 1-acylglycerol + H2O = a fatty acid + glycerol + H(+)
EC:3.1.1.23	0.548	acylglycerol lipase.

[back to server]