StarFunc result for job id O00522

User Input

>input (736 residues)
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQG
NSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDN
TKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGD
SELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00522	1.000	1.000	0.000	736	1.000	1.000	O00522.pdb.gz	KRIT1_HUMAN Krev interaction trapped protein 1 OS=Homo sapiens OX=9606 GN=KRIT1 PE=1 SV=2
2	AFDB:F1REV3	0.793	0.789	3.483E-104	740	0.781	0.777	F1REV3.pdb.gz	KRIT1_DANRE Krev interaction trapped protein 1 OS=Danio rerio OX=7955 GN=krit1 PE=1 SV=1
3	AFDB:G5EDH0	0.387	0.391	1.619E-30	729	0.226	0.228	G5EDH0.pdb.gz	G5EDH0_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kri-1 PE=2 SV=1
4	AFDB:Q3UFK8	0.393	0.607	3.556E-21	466	0.110	0.174	Q3UFK8.pdb.gz	FRMD8_MOUSE FERM domain-containing protein 8 OS=Mus musculus OX=10090 GN=Frmd8 PE=1 SV=2
5	AFDB:Q9BZ67	0.391	0.607	4.095E-21	464	0.105	0.166	Q9BZ67.pdb.gz	FRMD8_HUMAN FERM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=FRMD8 PE=1 SV=1
6	AFDB:E7F221	0.385	0.588	1.333E-19	471	0.113	0.176	E7F221.pdb.gz	FRMD8_DANRE FERM domain-containing protein 8 OS=Danio rerio OX=7955 GN=frmd8 PE=2 SV=1
7	AFDB:Q9VBX0	0.385	0.344	2.458E-19	828	0.114	0.101	Q9VBX0.pdb.gz	Q9VBX0_DROME Band4.1 inhibitor LRP interactor, isoform B OS=Drosophila melanogaster OX=7227 GN=Bili PE=2 SV=4
8	AFDB:Q55E74	0.347	0.513	6.656E-17	478	0.092	0.142	Q55E74.pdb.gz	FRMB_DICDI FERM domain-containing protein B OS=Dictyostelium discoideum OX=44689 GN=frmB PE=4 SV=1
9	AFDB:Q99MZ6	0.368	0.149	1.628E-16	2113	0.152	0.053	Q99MZ6.pdb.gz	MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus OX=10090 GN=Myo7b PE=1 SV=3
10	AFDB:Q8CJE3	0.357	0.141	3.981E-16	2177	0.140	0.047	Q8CJE3.pdb.gz	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
11	PDB:4rm8A	0.284	0.508	4.815E-11	368	0.080	0.160	4rm8A.pdb.gz
12	PDB:6r9tA	0.215	0.079	3.685E-7	2185	0.058	0.020	6r9tA.pdb.gz
13	PDB:8cs9A	0.159	0.147	7.149E-6	796	0.054	0.050	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:6jd6B	0.126	0.364	2.431E-5	192	0.052	0.198	6jd6B.pdb.gz
15	PDB:3ehqA	0.148	0.568	3.076E-5	182	0.048	0.192	3ehqA.pdb.gz
16	PDB:2dvwA	0.153	0.469	3.542E-5	229	0.056	0.179	2dvwA.pdb.gz
17	PDB:1bd8A	0.137	0.554	3.713E-5	156	0.046	0.218	1bd8A.pdb.gz
18	PDB:6pqpA	0.158	0.188	6.231E-5	615	0.084	0.101	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:4oauC	0.143	0.152	1.204E-4	692	0.095	0.101	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
20	PDB:6v9hC	0.147	0.379	1.454E-4	270	0.043	0.119	6v9hC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1REV3	0.0	1221	740	0.784	0.780	KRIT1_DANRE Krev interaction trapped protein 1 OS=Danio rerio OX=7955 GN=krit1 PE=1 SV=1
2	O00522	0.0	1538	736	1.000	1.000	KRIT1_HUMAN Krev interaction trapped protein 1 OS=Homo sapiens OX=9606 GN=KRIT1 PE=1 SV=2
3	Q6S5J6	0.0	1461	736	0.946	0.946	KRIT1_MOUSE Krev interaction trapped protein 1 OS=Mus musculus OX=10090 GN=Krit1 PE=1 SV=1
4	G5EDH0	2.55e-38	154	729	0.213	0.215	G5EDH0_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kri-1 PE=2 SV=1
5	G5EF18	2.00e-35	145	656	0.201	0.226	G5EF18_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kri-1 PE=4 SV=1
6	E7F221	2.05e-26	115	471	0.101	0.157	FRMD8_DANRE FERM domain-containing protein 8 OS=Danio rerio OX=7955 GN=frmd8 PE=2 SV=1
7	Q9VBX0	2.59e-23	108	828	0.113	0.100	Q9VBX0_DROME Band4.1 inhibitor LRP interactor, isoform B OS=Drosophila melanogaster OX=7227 GN=Bili PE=2 SV=4
8	Q3UFK8	1.17e-22	104	466	0.099	0.157	FRMD8_MOUSE FERM domain-containing protein 8 OS=Mus musculus OX=10090 GN=Frmd8 PE=1 SV=2
9	Q9BZ67	1.29e-22	103	464	0.098	0.155	FRMD8_HUMAN FERM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=FRMD8 PE=1 SV=1
10	Q6TGV5	3.16e-12	68.9	226	0.060	0.195	Q6TGV5_DANRE 26S proteasome non-ATPase regulatory subunit 10 OS=Danio rerio OX=7955 GN=PSMD10 PE=1 SV=1
11	B3CTB0	1.38e-11	68.9	336	0.056	0.122	B3CTB0_ORITI Ankyrin repeat-containing protein 06_02 OS=Orientia tsutsugamushi (strain Ikeda) OX=334380 GN=OTT_1149 PE=1 SV=1
12	Q8VHK2	1.46e-11	70.9	1430	0.056	0.029	CSKI1_RAT Caskin-1 OS=Rattus norvegicus OX=10116 GN=Caskin1 PE=1 SV=1
13	Q8WXD9	3.06e-11	69.7	1431	0.050	0.026	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
14	Q29Q26	8.00e-11	66.6	344	0.050	0.108	AKR2B_ARATH Ankyrin repeat domain-containing protein 2B OS=Arabidopsis thaliana OX=3702 GN=AKR2B PE=1 SV=1
15	Q9H4D1	2.52e-10	66.2	784	0.057	0.054	Q9H4D1_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=dik PE=2 SV=1
16	P57078	2.78e-10	66.2	832	0.057	0.050	RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1
17	M9MSQ2	3.47e-10	66.2	1544	0.062	0.030	M9MSQ2_DROME Forked, isoform I OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
18	Q0KHR2	3.67e-10	66.2	1918	0.062	0.024	Q0KHR2_DROME Forked, isoform F OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
19	Q86B49	4.05e-10	65.9	1509	0.062	0.030	Q86B49_DROME Forked, isoform C OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
20	Q6PG48	4.46e-10	64.3	330	0.057	0.127	Q6PG48_HUMAN ANKRD12 protein OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.1e-06	39.1	Ankyrin repeat
2	PF12796 Ank_2	1.5e-12	59.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.024	26.0	Ankyrin repeat
4	PF13637 Ank_4	1.3e-07	43.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.9e-10	51.0	Ankyrin repeats (many copies)
6	PF00373 FERM_M	1.3e-13	62.7	FERM central domain
7	PF16705 NUDIX_5	1.3e-79	277.6	NUDIX, or N-terminal NPxY motif-rich, region of KRIT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378015

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353850	0.999	Integrin beta-1-binding protein 1
2	9606.ENSP00000370503	0.999	Cerebral cavernous malformations 2 protein
3	9606.ENSP00000311502	0.998	Protein HEG homolog 1
4	9606.ENSP00000358723	0.998	Ras-related protein Rap-1A
5	9606.ENSP00000250559	0.996	Ras-related protein Rap-1b
6	9606.ENSP00000376506	0.987	Programmed cell death protein 10
7	9606.ENSP00000344456	0.986	Catenin beta-1
8	9606.ENSP00000344115	0.956	Cadherin-5
9	9606.ENSP00000245304	0.886	Ras-related protein Rap-2a
10	9606.ENSP00000354927	0.860	Mitogen-activated protein kinase kinase kinase 3
11	9606.ENSP00000262659	0.846	Cerebral cavernous malformations 2 protein-like
12	9606.ENSP00000233575	0.836	Sorting nexin-17
13	9606.ENSP00000375960	0.768	Afadin
14	9606.ENSP00000296702	0.748	Transcription elongation regulator 1
15	9606.ENSP00000377867	0.746	Serine/threonine-protein kinase 26
16	9606.ENSP00000317985	0.653	Rho-associated protein kinase 2
17	9606.ENSP00000362299	0.642	Endoglin
18	9606.ENSP00000325748	0.638	Serine/threonine-protein kinase 25
19	9606.ENSP00000228841	0.630	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
20	9606.ENSP00000314543	0.614	Melanoma-associated antigen B18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030695	1.000	GTPase regulator activity
GO:0008092	0.993	cytoskeletal protein binding
GO:0043167	0.931	ion binding
GO:0008289	0.919	lipid binding
GO:0043168	0.918	anion binding
GO:0005543	0.908	phospholipid binding
GO:0035091	0.900	phosphatidylinositol binding
GO:1902936	0.880	phosphatidylinositol bisphosphate binding
GO:0008017	0.877	microtubule binding
GO:0005546	0.853	phosphatidylinositol-4,5-bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0048519	0.991	negative regulation of biological process
GO:0022603	0.985	regulation of anatomical structure morphogenesis
GO:0051239	0.978	regulation of multicellular organismal process
GO:0032878	0.978	regulation of establishment or maintenance of cell polarity
GO:0048523	0.978	negative regulation of cellular process
GO:0050896	0.958	response to stimulus
GO:0045765	0.955	regulation of angiogenesis
GO:0016043	0.946	cellular component organization
GO:0051241	0.936	negative regulation of multicellular organismal process
GO:2000114	0.935	regulation of establishment of cell polarity
GO:1901343	0.932	negative regulation of vasculature development
GO:0016525	0.907	negative regulation of angiogenesis
GO:0045454	0.894	cell redox homeostasis
GO:0051716	0.839	cellular response to stimulus
GO:0048518	0.827	positive regulation of biological process
GO:0008285	0.825	negative regulation of cell population proliferation
GO:0007165	0.822	signal transduction
GO:0060548	0.806	negative regulation of cell death
GO:0043069	0.797	negative regulation of programmed cell death
GO:0030334	0.796	regulation of cell migration
GO:0043066	0.793	negative regulation of apoptotic process
GO:0048522	0.696	positive regulation of cellular process
GO:0019222	0.683	regulation of metabolic process
GO:0065009	0.660	regulation of molecular function
GO:0035556	0.595	intracellular signal transduction
GO:0022607	0.540	cellular component assembly
GO:0048856	0.515	anatomical structure development
GO:0030336	0.513	negative regulation of cell migration
GO:0048583	0.504	regulation of response to stimulus
GO:0060255	0.499	regulation of macromolecule metabolic process
GO:0032501	0.481	multicellular organismal process
GO:0050678	0.454	regulation of epithelial cell proliferation
GO:0010594	0.420	regulation of endothelial cell migration
GO:0008152	0.395	metabolic process
GO:0030154	0.390	cell differentiation
GO:0009893	0.383	positive regulation of metabolic process
GO:0009966	0.375	regulation of signal transduction
GO:0044238	0.372	primary metabolic process
GO:0051171	0.363	regulation of nitrogen compound metabolic process
GO:0042221	0.353	response to chemical
GO:0031323	0.349	regulation of cellular metabolic process
GO:0009888	0.341	tissue development
GO:0051128	0.337	regulation of cellular component organization
GO:0071704	0.314	organic substance metabolic process
GO:0010604	0.311	positive regulation of macromolecule metabolic process
GO:0070887	0.306	cellular response to chemical stimulus
GO:0009653	0.305	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005886	0.995	plasma membrane
GO:0032991	0.992	protein-containing complex
GO:0043227	0.977	membrane-bounded organelle
GO:0005576	0.970	extracellular region
GO:0005829	0.960	cytosol
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0005615	0.933	extracellular space
GO:0030054	0.931	cell junction
GO:0070161	0.894	anchoring junction
GO:0005911	0.874	cell-cell junction
GO:0005634	0.422	nucleus
GO:0070062	0.368	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]