StarFunc result for job id O00533

User Input

>input (1208 residues)
MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAK
GNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMS
EEIEFIVPSVPKFPKEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIELEHIEQDERV
YMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSSNSIKQRKPKLLLP
PTESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGGDLPKGRETKENYGKTLKIENV
SYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGILLCEAEGEPQP
TIKWRVNGSPVDNHPFAGDVVFPREISFTNLQPNHTAVYQCEASNVHGTILANANIDVVD
VRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEGRRYHIYENGTLQ
INRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKC
DSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSA
ADITQVTVLDVPDPPENLHLSERQNRSVRLTWEAGADHNSNISEYIVEFEGNKEEPGRWE
ELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQPSDHHETPPAAPDRNPQNIRV
QASQPKEMIIKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEETVTNHTLRVMTPAVYAP
YDVKVQAINQLGSGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKDRVHG
RLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDAFSEFHLTVLAYNSKGA
GPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTY
EIGELNDINITTPSKPSWHLSNLNATTKYKFYLRACTSQGCGKPITEESSTLGEGSKGIG
KISGVNLTQKTHPIEVFEPGAEHIVRLMTKNWGDNDSIFQDVIETRGREYAGLYDDISTQ
GWFIGLMCAIALLTLLLLTVCFVKRNRGGKYSVKEKEDLHPDPEIQSVKDETFGEYSDSD
EKPLKGSLRSLNRDMQPTESADSLVEYGEGDHGLFSEDGSFIGAYAGSKEKGSVESNGSS
TATFPLRA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0RC17	0.441	0.440	0.000	1210	0.790	0.788	M0RC17.pdb.gz	M0RC17_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=1 SV=3
2	AFDB:O00533	1.000	1.000	0.000	1208	1.000	1.000	O00533.pdb.gz	NCHL1_HUMAN Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4
3	AFDB:O94856	0.359	0.325	0.000	1347	0.389	0.349	O94856.pdb.gz	NFASC_HUMAN Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 SV=4
4	AFDB:P11627	0.449	0.434	0.000	1260	0.383	0.367	P11627.pdb.gz	L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus musculus OX=10090 GN=L1cam PE=1 SV=1
5	AFDB:P35331	0.417	0.394	0.000	1284	0.417	0.393	P35331.pdb.gz	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1
6	AFDB:P97685	0.403	0.394	7.716E-103	1240	0.360	0.351	P97685.pdb.gz	NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 GN=Nfasc PE=1 SV=2
7	AFDB:Q90933	0.392	0.373	5.061E-102	1280	0.357	0.337	Q90933.pdb.gz	Q90933_CHICK Neuron-glia cell adhesion molecule (Ng-CAM) OS=Gallus gallus OX=9031 PE=2 SV=1
8	AFDB:Q90478	0.332	0.335	2.295E-98	1197	0.330	0.333	Q90478.pdb.gz	L1CA1_DANRE Neural cell adhesion molecule L1.1 (Fragment) OS=Danio rerio OX=7955 GN=nadl1.1 PE=2 SV=1
9	AFDB:P20241	0.402	0.380	4.561E-94	1302	0.290	0.269	P20241.pdb.gz	NRG_DROME Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2
10	AFDB:B3DH04	0.326	0.371	3.028E-84	1040	0.228	0.265	B3DH04.pdb.gz
11	PDB:5oj2B	0.131	0.197	6.420E-26	692	0.109	0.191	5oj2B.pdb.gz
12	PDB:1e07A	0.116	0.188	7.654E-21	642	0.096	0.181	1e07A.pdb.gz
13	PDB:7sqcO0	0.125	0.131	2.490E-16	1140	0.080	0.085	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:7q1yA	0.100	0.092	1.091E-15	1374	0.079	0.069	7q1yA.pdb.gz
15	PDB:5a42A	0.106	0.086	1.428E-15	1597	0.090	0.068	5a42A.pdb.gz
16	PDB:7q5zA	0.101	0.092	1.493E-15	1344	0.070	0.063	7q5zA.pdb.gz
17	PDB:6dldD	0.125	0.488	4.375E-15	269	0.053	0.238	6dldD.pdb.gz
18	PDB:6h03A	0.109	0.108	1.052E-13	1223	0.063	0.062	6h03A.pdb.gz
19	PDB:6dlfA	0.129	0.590	1.439E-13	236	0.047	0.242	6dlfA.pdb.gz
20	PDB:7vonA	0.096	0.089	2.355E-13	1399	0.072	0.062	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y8T8	0.0	2137	1209	0.860	0.859	A0A8I5Y8T8_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
2	A0A8I5YCG7	0.0	2056	1177	0.834	0.856	A0A8I5YCG7_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
3	A0A8I6A9A6	0.0	2009	1170	0.821	0.848	A0A8I6A9A6_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
4	M0RC17	0.0	2128	1224	0.859	0.848	M0RC17_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=1 SV=3
5	O00533	0.0	2507	1208	1.000	1.000	NCHL1_HUMAN Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4
6	O94856	0.0	689	1347	0.324	0.290	NFASC_HUMAN Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 SV=4
7	P11627	0.0	788	1260	0.398	0.382	L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus musculus OX=10090 GN=L1cam PE=1 SV=1
8	P32004	0.0	804	1257	0.397	0.381	L1CAM_HUMAN Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2
9	P35331	0.0	852	1284	0.423	0.398	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1
10	P70232	0.0	2117	1209	0.849	0.848	NCHL1_MOUSE Neural cell adhesion molecule L1-like protein OS=Mus musculus OX=10090 GN=Chl1 PE=1 SV=2
11	P97685	0.0	589	1240	0.286	0.278	NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 GN=Nfasc PE=1 SV=2
12	P97686	0.0	831	1214	0.410	0.408	NRCAM_RAT Neuronal cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Nrcam PE=1 SV=2
13	Q03696	0.0	667	1266	0.351	0.335	NGCA_CHICK Neuronal-glial cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=2
14	Q05695	0.0	793	1259	0.397	0.380	L1CAM_RAT Neural cell adhesion molecule L1 OS=Rattus norvegicus OX=10116 GN=L1cam PE=1 SV=3
15	Q810U3	0.0	589	1240	0.285	0.277	NFASC_MOUSE Neurofascin OS=Mus musculus OX=10090 GN=Nfasc PE=1 SV=1
16	Q810U4	0.0	854	1256	0.415	0.399	NRCAM_MOUSE Neuronal cell adhesion molecule OS=Mus musculus OX=10090 GN=Nrcam PE=1 SV=2
17	Q90478	0.0	662	1197	0.345	0.348	L1CA1_DANRE Neural cell adhesion molecule L1.1 (Fragment) OS=Danio rerio OX=7955 GN=nadl1.1 PE=2 SV=1
18	Q90933	0.0	719	1280	0.365	0.345	Q90933_CHICK Neuron-glia cell adhesion molecule (Ng-CAM) OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q92823	0.0	830	1304	0.421	0.390	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
20	P20241	1.68e-134	444	1302	0.295	0.273	NRG_DROME Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	12	17.1	Adenovirus E3 region protein CR1
2	PF13882 Bravo_FIGEY	2.3e-25	100.9	Bravo-like intracellular region
3	PF08205 C2-set_2	0.23	22.9	CD80-like C2-set immunoglobulin domain
4	PF00041 fn3	6.1e-44	159.6	Fibronectin type III domain
5	PF16794 fn3_4	13	17.2	Fibronectin-III type domain
6	PF20418 Herpes_gE_N	2.5e+02	12.9	Alphaherpesvirus glycoprotein E N-terminal
7	PF07679 I-set	2.6e-57	202.2	Immunoglobulin I-set domain
8	PF03921 ICAM_N	98	14.1	Intercellular adhesion molecule (ICAM), N-terminal domain
9	PF00047 ig	8.8e-39	142.9	Immunoglobulin domain
10	PF13895 Ig_2	3.5e-39	144.3	Immunoglobulin domain
11	PF13927 Ig_3	2.1e-62	218.9	Immunoglobulin domain
12	PF16680 Ig_4	0.3	23.0	T-cell surface glycoprotein CD3 delta chain
13	PF16681 Ig_5	0.13	24.0	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
14	PF18452 Ig_6	0.15	23.3	Immunoglobulin domain
15	PF16706 Izumo-Ig	0.0083	27.4	Izumo-like Immunoglobulin domain
16	PF07686 V-set	1.2e-13	62.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256509

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347591	0.980	GDNF family receptor alpha-1
2	9606.ENSP00000409007	0.975	Glial cell line-derived neurotrophic factor
3	9606.ENSP00000398632	0.951	CD44 antigen
4	9606.ENSP00000368752	0.946	Major prion protein
5	9606.ENSP00000265371	0.938	Neuropilin-1
6	9606.ENSP00000407822	0.907	Contactin-6
7	9606.ENSP00000346671	0.900	Tyrosine-protein kinase Fyn
8	9606.ENSP00000231461	0.896	CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase
9	9606.ENSP00000265709	0.882	Ankyrin-1
10	9606.ENSP00000252575	0.845	Neurocan core protein
11	9606.ENSP00000482957	0.827	Rho family-interacting cell polarization regulator 2
12	9606.ENSP00000377047	0.809	Receptor-type tyrosine-protein phosphatase zeta
13	9606.ENSP00000432083	0.808	Heat shock cognate 71 kDa protein
14	9606.ENSP00000263233	0.799	Synaptophysin
15	9606.ENSP00000268164	0.782	Alpha-2,8-sialyltransferase 8B
16	9606.ENSP00000368678	0.781	Agrin
17	9606.ENSP00000369756	0.773	Receptor-type tyrosine-protein phosphatase alpha
18	9606.ENSP00000269141	0.768	Cadherin-2
19	9606.ENSP00000277120	0.754	BDNF/NT-3 growth factors receptor
20	9606.ENSP00000379839	0.739	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0050839	0.888	cell adhesion molecule binding
GO:0005102	0.629	signaling receptor binding
GO:0044877	0.480	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032501	0.996	multicellular organismal process
GO:0050896	0.995	response to stimulus
GO:0048856	0.991	anatomical structure development
GO:0007399	0.982	nervous system development
GO:0030154	0.980	cell differentiation
GO:0016043	0.964	cellular component organization
GO:0065007	0.956	biological regulation
GO:0050789	0.948	regulation of biological process
GO:0051716	0.930	cellular response to stimulus
GO:0022008	0.918	neurogenesis
GO:0050794	0.916	regulation of cellular process
GO:0048699	0.913	generation of neurons
GO:0048468	0.905	cell development
GO:0030030	0.889	cell projection organization
GO:0030182	0.887	neuron differentiation
GO:0048666	0.870	neuron development
GO:0031175	0.853	neuron projection development
GO:0061564	0.743	axon development
GO:0006950	0.738	response to stress
GO:0007154	0.721	cell communication
GO:0009611	0.684	response to wounding
GO:0048678	0.670	response to axon injury
GO:0031102	0.636	neuron projection regeneration
GO:0023052	0.614	signaling
GO:0031103	0.604	axon regeneration
GO:0007165	0.475	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005886	0.993	plasma membrane
GO:0043226	0.981	organelle
GO:0043227	0.958	membrane-bounded organelle
GO:0005622	0.911	intracellular anatomical structure
GO:0005576	0.906	extracellular region
GO:0005615	0.837	extracellular space
GO:0031982	0.818	vesicle
GO:1903561	0.715	extracellular vesicle
GO:0070062	0.711	extracellular exosome
GO:0043231	0.702	intracellular membrane-bounded organelle
GO:0005737	0.677	cytoplasm
GO:0043005	0.605	neuron projection
GO:0030054	0.325	cell junction
GO:0036477	0.307	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]