StarFunc result for job id O00548

User Input

>input (723 residues)
MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
KICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREK
DISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSK
RDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIA
TEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00548	1.000	1.000	0.000	723	1.000	1.000	O00548.pdb.gz	DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2
2	AFDB:Q61483	0.640	0.641	0.000	722	0.884	0.885	Q61483.pdb.gz	DLL1_MOUSE Delta-like protein 1 OS=Mus musculus OX=10090 GN=Dll1 PE=1 SV=2
3	AFDB:Q8UWJ4	0.560	0.564	0.000	717	0.705	0.711	Q8UWJ4.pdb.gz	DLLD_DANRE Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2
4	AFDB:Q6DI48	0.584	0.550	1.910E-103	772	0.679	0.636	Q6DI48.pdb.gz	DLLA_DANRE Delta-like protein A OS=Danio rerio OX=7955 GN=dla PE=1 SV=1
5	AFDB:O57409	0.496	0.574	1.024E-77	615	0.437	0.514	O57409.pdb.gz	DLLB_DANRE Delta-like protein B OS=Danio rerio OX=7955 GN=dlb PE=1 SV=1
6	AFDB:P10041	0.414	0.361	2.091E-69	833	0.400	0.347	P10041.pdb.gz	DL_DROME Neurogenic locus protein delta OS=Drosophila melanogaster OX=7227 GN=Delta PE=1 SV=2
7	AFDB:Q90Y54	0.388	0.236	5.206E-63	1213	0.314	0.187	Q90Y54.pdb.gz	JAG1B_DANRE Protein jagged-1b OS=Danio rerio OX=7955 GN=jag1b PE=2 SV=1
8	AFDB:A0A2R8QT22	0.347	0.213	4.205E-60	1216	0.321	0.191	A0A2R8QT22.pdb.gz
9	AFDB:Q63722	0.389	0.235	7.346E-60	1219	0.320	0.189	Q63722.pdb.gz	JAG1_RAT Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2
10	AFDB:A0A0R4IAF3	0.369	0.223	5.307E-57	1254	0.288	0.166	A0A0R4IAF3.pdb.gz
11	PDB:7q3nU	0.082	0.166	2.140E-5	292	0.065	0.161	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:3nsjA	0.133	0.173	2.945E-4	530	0.029	0.040	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
13	PDB:5ixcA	0.140	0.148	3.893E-4	684	0.022	0.023	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:4g1eB	0.089	0.091	4.602E-4	709	0.084	0.086	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
15	PDB:5izrC	0.139	0.151	7.191E-4	659	0.028	0.030	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:1cjyA	0.130	0.147	1.963E-3	633	0.017	0.019	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
17	PDB:7jvxA	0.116	0.228	3.243E-3	314	0.028	0.064	7jvxA.pdb.gz
18	PDB:5iz5A	0.138	0.132	3.834E-3	757	0.022	0.021	5iz5A.pdb.gz
19	PDB:5a50A	0.129	0.470	4.532E-3	165	0.015	0.067	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:5iz5B	0.141	0.137	6.334E-3	746	0.030	0.029	5iz5B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00548	0.0	1476	723	1.000	1.000	DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2
2	O57409	0.0	602	615	0.437	0.514	DLLB_DANRE Delta-like protein B OS=Danio rerio OX=7955 GN=dlb PE=1 SV=1
3	P97677	0.0	1274	714	0.882	0.894	DLL1_RAT Delta-like protein 1 OS=Rattus norvegicus OX=10116 GN=Dll1 PE=1 SV=1
4	Q1ECY3	0.0	646	683	0.501	0.530	Q1ECY3_DANRE Delta-like protein OS=Danio rerio OX=7955 GN=zgc:136596 PE=2 SV=1
5	Q61483	0.0	1287	722	0.885	0.886	DLL1_MOUSE Delta-like protein 1 OS=Mus musculus OX=10090 GN=Dll1 PE=1 SV=2
6	Q6DI48	0.0	948	772	0.675	0.632	DLLA_DANRE Delta-like protein A OS=Danio rerio OX=7955 GN=dla PE=1 SV=1
7	Q8UWJ4	0.0	1049	717	0.703	0.709	DLLD_DANRE Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2
8	Q90656	0.0	1221	728	0.824	0.819	Q90656_CHICK Delta-like protein OS=Gallus gallus OX=9031 PE=2 SV=1
9	Q9IAT6	0.0	641	664	0.461	0.502	DLLC_DANRE Delta-like protein C OS=Danio rerio OX=7955 GN=dlc PE=2 SV=1
10	Q9JI71	0.0	600	686	0.479	0.504	DLL4_MOUSE Delta-like protein 4 OS=Mus musculus OX=10090 GN=Dll4 PE=1 SV=2
11	Q9NR61	0.0	617	685	0.483	0.509	DLL4_HUMAN Delta-like protein 4 OS=Homo sapiens OX=9606 GN=DLL4 PE=1 SV=1
12	P10041	4.09e-167	503	833	0.378	0.328	DL_DROME Neurogenic locus protein delta OS=Drosophila melanogaster OX=7227 GN=Delta PE=1 SV=2
13	Q63722	5.33e-136	432	1219	0.313	0.185	JAG1_RAT Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2
14	P78504	1.06e-135	432	1218	0.311	0.185	JAG1_HUMAN Protein jagged-1 OS=Homo sapiens OX=9606 GN=JAG1 PE=1 SV=3
15	Q9QXX0	1.19e-135	432	1218	0.313	0.186	JAG1_MOUSE Protein jagged-1 OS=Mus musculus OX=10090 GN=Jag1 PE=1 SV=1
16	Q90Y54	4.70e-134	427	1213	0.318	0.190	JAG1B_DANRE Protein jagged-1b OS=Danio rerio OX=7955 GN=jag1b PE=2 SV=1
17	Q90Y57	3.84e-130	417	1242	0.318	0.185	JAG1A_DANRE Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1
18	Q9Y219	4.48e-126	406	1238	0.307	0.179	JAG2_HUMAN Protein jagged-2 OS=Homo sapiens OX=9606 GN=JAG2 PE=1 SV=3
19	Q9QYE5	5.36e-123	398	1247	0.318	0.184	JAG2_MOUSE Protein jagged-2 OS=Mus musculus OX=10090 GN=Jag2 PE=2 SV=2
20	P97607	7.79e-120	389	1202	0.282	0.170	JAG2_RAT Protein jagged-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Jag2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01414 DSL	2.7e-16	70.9	Delta serrate ligand
2	PF15820 ECSCR	34	15.7	Endothelial cell-specific chemotaxis regulator
3	PF00008 EGF	3e-39	144.2	EGF-like domain
4	PF07974 EGF_2	0.00049	31.7	EGF-like domain
5	PF12947 EGF_3	9.8e-06	37.0	EGF domain
6	PF07645 EGF_CA	0.078	24.5	Calcium-binding EGF domain
7	PF12661 hEGF	2.6e-20	83.5	Human growth factor-like EGF
8	PF07657 MNNL	3.3e-47	171.4	N terminus of Notch ligand C2-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355718

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261537	0.994	E3 ubiquitin-protein ligase MIB1
2	9606.ENSP00000256646	0.985	Neurogenic locus notch homolog protein 2
3	9606.ENSP00000358815	0.985	E3 ubiquitin-protein ligase NEURL1B
4	9606.ENSP00000358795	0.984	E3 ubiquitin-protein ligase NEURL1
5	9606.ENSP00000260408	0.975	Disintegrin and metalloproteinase domain-containing protein 10
6	9606.ENSP00000263388	0.975	Neurogenic locus notch homolog protein 3
7	9606.ENSP00000277541	0.968	Neurogenic locus notch homolog protein 1
8	9606.ENSP00000257600	0.964	E3 ubiquitin-protein ligase DTX1
9	9606.ENSP00000309968	0.953	Disintegrin and metalloproteinase domain-containing protein 17
10	9606.ENSP00000294785	0.951	Nicastrin
11	9606.ENSP00000328169	0.944	Protein jagged-2
12	9606.ENSP00000426103	0.943	E3 ubiquitin-protein ligase MIB2
13	9606.ENSP00000254958	0.941	Protein jagged-1
14	9606.ENSP00000358105	0.939	Gamma-secretase subunit APH-1A
15	9606.ENSP00000468411	0.939	Gamma-secretase subunit PEN-2
16	9606.ENSP00000261879	0.931	Gamma-secretase subunit APH-1B
17	9606.ENSP00000357668	0.923	Disintegrin and metalloproteinase domain-containing protein 12
18	9606.ENSP00000205143	0.918	Delta-like protein 3
19	9606.ENSP00000249749	0.909	Delta-like protein 4
20	9606.ENSP00000360798	0.909	Epidermal growth factor receptor substrate 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005112	1.000	Notch binding
GO:0140677	0.970	molecular function activator activity
GO:0030545	0.955	signaling receptor regulator activity
GO:0048018	0.949	receptor ligand activity
GO:0140297	0.440	DNA-binding transcription factor binding
GO:0061629	0.346	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0048856	0.991	anatomical structure development
GO:0009987	0.987	cellular process
GO:0032501	0.983	multicellular organismal process
GO:0050896	0.975	response to stimulus
GO:0048731	0.968	system development
GO:0048519	0.963	negative regulation of biological process
GO:0048523	0.920	negative regulation of cellular process
GO:0048869	0.907	cellular developmental process
GO:0030154	0.896	cell differentiation
GO:0019222	0.890	regulation of metabolic process
GO:0060255	0.869	regulation of macromolecule metabolic process
GO:0048518	0.866	positive regulation of biological process
GO:0048522	0.842	positive regulation of cellular process
GO:0010468	0.838	regulation of gene expression
GO:0051171	0.830	regulation of nitrogen compound metabolic process
GO:0080090	0.817	regulation of primary metabolic process
GO:0051093	0.803	negative regulation of developmental process
GO:0007399	0.794	nervous system development
GO:0031323	0.787	regulation of cellular metabolic process
GO:0009893	0.762	positive regulation of metabolic process
GO:0007219	0.759	Notch signaling pathway
GO:0048583	0.737	regulation of response to stimulus
GO:0010604	0.737	positive regulation of macromolecule metabolic process
GO:0051239	0.716	regulation of multicellular organismal process
GO:0009966	0.700	regulation of signal transduction
GO:0045595	0.689	regulation of cell differentiation
GO:0048513	0.615	animal organ development
GO:0051241	0.587	negative regulation of multicellular organismal process
GO:0045596	0.557	negative regulation of cell differentiation
GO:0009889	0.555	regulation of biosynthetic process
GO:0009653	0.546	anatomical structure morphogenesis
GO:0019219	0.498	regulation of nucleobase-containing compound metabolic process
GO:0009892	0.497	negative regulation of metabolic process
GO:0010556	0.485	regulation of macromolecule biosynthetic process
GO:0031326	0.484	regulation of cellular biosynthetic process
GO:0051252	0.480	regulation of RNA metabolic process
GO:0048584	0.479	positive regulation of response to stimulus
GO:0042127	0.474	regulation of cell population proliferation
GO:0010605	0.468	negative regulation of macromolecule metabolic process
GO:0006355	0.468	regulation of DNA-templated transcription
GO:0008593	0.454	regulation of Notch signaling pathway
GO:0006357	0.444	regulation of transcription by RNA polymerase II
GO:0051173	0.433	positive regulation of nitrogen compound metabolic process
GO:0009967	0.424	positive regulation of signal transduction
GO:0031325	0.418	positive regulation of cellular metabolic process
GO:0045165	0.338	cell fate commitment
GO:0045935	0.304	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.913	intracellular anatomical structure
GO:0005737	0.840	cytoplasm
GO:0043231	0.832	intracellular membrane-bounded organelle
GO:0070013	0.353	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]