StarFunc result for job id O00555

User Input

>input (2506 residues)
MARFGDEMPARYGGGGSGAAAGVVVGSGGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMA
LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALEQH
LPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTG
ILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIF
AIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQ
FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS
GEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDAL
RRTTIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYIR
RMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYGL
GTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASLR
NLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMTV
FQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQ
ELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQRTSE
MRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTNKSRA
AEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRE
SDHHAREGSLEQPGFWEGEAERGKAGDPHRRHVHRQGGSRESRSGSPRTGADGEHRRHRA
HRRPGEEGPEDKAERRARHREGSRPARGGEGEGEGPDGGERRRRHRHGAPATYEGDARRE
DKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAA
PHGSLGHAGLPQSPAKMGNSTDPGPMLAIPAMATNPQNAASRRTPNNPGNPSNPGPPKTP
ENSLIVTNPSGTQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQVNKNANPDPLPKKEEE
KKEEEEDDRGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIAL
AAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVV
SGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNIL
IVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEF
HYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFF
FVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQ
FVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKVMAFG
ILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRIL
LWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNNFRT
FFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFL
MLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAAWGRMPYLDMYQMLRHMSP
PLGLGKKCPARVAYKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDA
ELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQ
DRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGGALMAHESGLKESPSWVTQRAQEMFQ
KTGTWSPEQGPPTDMPNSQPNSQSVEMREMGRDGYSDSEHYLPMEGQGRAASMPRLPAEN
QRRRGRPRGNNLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRSH
RASERSLGRYTDVDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHHHHHHHP
PPPDKDRYAQERPDHGRARARDQRWSRSPSEGREHMAHRQGSSSVSGSPAPSTSGTSTPR
RGRRQLPQTPSTPRPHVSYSPVIRKAGGSGPPQQQQQQQQQQQQQAVARPGRAATSGPRR
YPGPTAEPLAGDRPPTGGHSSGRSPRMERRVPGPARSESPRACRHGGARWPASGPHVSEG
PPGPRHHGYYRGSDYDEADGPGSGGGEEAMAGAYDAPPPVRHASSGATGRSPRTPRASGP
ACASPSRHGRRLPNGYYPAHGLARPRGPGSRKGLHEPYSESDDDWC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mixA	0.499	0.926	0.000	1326	0.438	0.828	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
2	PDB:7vfsA	0.478	0.928	0.000	1266	0.423	0.838	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
3	AFDB:A0A0R4IFN9	0.640	0.688	0.000	2319	0.683	0.738	A0A0R4IFN9.pdb.gz
4	AFDB:O00555	0.999	0.999	0.000	2506	1.000	1.000	O00555.pdb.gz	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
5	AFDB:P27884	0.672	0.694	0.000	2424	0.858	0.887	P27884.pdb.gz	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
6	AFDB:P97445	0.637	0.673	0.000	2368	0.874	0.925	P97445.pdb.gz	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2
7	AFDB:Q00975	0.593	0.634	0.000	2339	0.607	0.650	Q00975.pdb.gz	CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1
8	AFDB:Q15878	0.594	0.641	0.000	2313	0.545	0.591	Q15878.pdb.gz	CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens OX=9606 GN=CACNA1E PE=1 SV=3
9	AFDB:Q61290	0.574	0.632	0.000	2272	0.540	0.595	Q61290.pdb.gz	CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus OX=10090 GN=Cacna1e PE=1 SV=1
10	PDB:7uhfA	0.469	0.941	6.470E-86	1230	0.265	0.540	7uhfA.pdb.gz	Structural basis for pore blockade of human voltage-gated calcium channel Ca v 1.3 by motion sickness drug cinnarizine.
11	PDB:5gjwA	0.491	0.938	1.110E-80	1291	0.264	0.512	5gjwA.pdb.gz	Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
12	PDB:7jpxA	0.426	0.945	1.387E-76	1116	0.241	0.542	7jpxA.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
13	AFDB:O88427	0.427	0.451	6.122E-67	2365	0.224	0.237	O88427.pdb.gz	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
14	AFDB:Q5SUF7	0.431	0.453	7.063E-66	2381	0.218	0.229	Q5SUF7.pdb.gz	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
15	AFDB:O95180	0.427	0.453	3.335E-63	2353	0.227	0.242	O95180.pdb.gz	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
16	PDB:7w9lA	0.426	0.729	3.954E-54	1420	0.158	0.278	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
17	PDB:7xveA	0.403	0.766	2.959E-49	1276	0.146	0.286	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
18	PDB:7we4A	0.399	0.864	9.210E-49	1122	0.132	0.294	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
19	PDB:7wliA	0.392	0.834	1.697E-48	1135	0.142	0.315	7wliA.pdb.gz	Structure, gating, and pharmacology of human Ca V 3.3 channel.
20	PDB:6agfA	0.404	0.867	1.381E-47	1138	0.138	0.304	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZMH8	744	1960	0.150	0.191	A0A8I5ZMH8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
2	A0A8I5ZS49	745	1973	0.149	0.190	A0A8I5ZS49_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
3	A1XIQ4	744	1980	0.150	0.189	A1XIQ4_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=2 SV=1
4	F8W3Z0	2913	2280	0.669	0.735	F8W3Z0_DANRE Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b OS=Danio rerio OX=7955 GN=CACNA1Ab PE=2 SV=2
5	G3V9W8	744	1980	0.150	0.189	G3V9W8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
6	G5EFB0	691	1523	0.159	0.262	G5EFB0_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-2 PE=3 SV=2
7	G5EG02	740	1783	0.148	0.208	G5EG02_CAEEL Voltage-dependent L-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=egl-19 PE=1 SV=1
8	O00555	5226	2506	1.000	1.000	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
9	O35505	635	2169	0.144	0.166	CAC1C_CAVPO Voltage-dependent L-type calcium channel subunit alpha-1C OS=Cavia porcellus OX=10141 GN=CACNA1C PE=1 SV=2
10	O55017	2652	2327	0.583	0.628	CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus OX=10090 GN=Cacna1b PE=1 SV=1
11	O60840	742	1977	0.149	0.189	CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens OX=9606 GN=CACNA1F PE=1 SV=2
12	O70368	1262	791	0.270	0.855	O70368_RAT Class A calcium channel variant riA-I (Fragment) OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
13	O89089	2660	2333	0.598	0.643	O89089_RAT Voltage-dependent N-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1b PE=1 SV=1
14	P07293	610	1873	0.133	0.178	CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1
15	P15381	640	2171	0.146	0.169	CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus OX=9986 GN=CACNA1C PE=1 SV=1
16	P22002	627	2169	0.142	0.165	CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus OX=10116 GN=Cacna1c PE=1 SV=1
17	P27732	755	2203	0.154	0.175	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
18	P27884	3962	2424	0.831	0.859	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
19	P54282	3840	2212	0.818	0.927	CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
20	P91645	1003	1851	0.198	0.268	CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=cac PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08763 Ca_chan_IQ	4.3e-27	105.5	Voltage gated calcium channel IQ domain
2	PF16905 GPHH	1.6e-25	100.0	Voltage-dependent L-type calcium channel, IQ-associated
3	PF00520 Ion_trans	3.1e-243	814.3	Ion transport protein
4	PF08016 PKD_channel	0.0025	28.8	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353362

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438949	0.987	Voltage-dependent L-type calcium channel subunit beta-4
2	9606.ENSP00000418081	0.956	Voltage-dependent calcium channel subunit alpha-2/delta-2
3	9606.ENSP00000286548	0.942	Guanine nucleotide-binding protein G(q) subunit alpha
4	9606.ENSP00000481878	0.940	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
5	9606.ENSP00000263431	0.928	Protein kinase C gamma type
6	9606.ENSP00000349467	0.920	Calmodulin-1
7	9606.ENSP00000320025	0.912	Voltage-dependent L-type calcium channel subunit beta-2
8	9606.ENSP00000377840	0.909	Voltage-dependent L-type calcium channel subunit beta-1
9	9606.ENSP00000291295	0.908	Calmodulin 3 (phosphorylase kinase, delta)
10	9606.ENSP00000400175	0.906	Transforming protein RhoA
11	9606.ENSP00000275364	0.904	Guanine nucleotide-binding protein subunit alpha-12
12	9606.ENSP00000371897	0.904	Rho GTPase-activating protein 5
13	9606.ENSP00000400717	0.904	Guanine nucleotide-binding protein subunit alpha-13
14	9606.ENSP00000348461	0.903	Ras-related C3 botulinum toxin substrate 1
15	9606.ENSP00000419101	0.903	Voltage-dependent calcium channel subunit alpha-2/delta-3
16	9606.ENSP00000301050	0.902	Voltage-dependent L-type calcium channel subunit beta-3
17	9606.ENSP00000352608	0.902	Ryanodine receptor 1
18	9606.ENSP00000248572	0.901	Guanine nucleotide-binding protein G(T) subunit gamma-T1
19	9606.ENSP00000300105	0.901	Voltage-dependent calcium channel gamma-2 subunit
20	9606.ENSP00000360423	0.896	Voltage-dependent N-type calcium channel subunit alpha-1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008331	0.999	high voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.994	biological regulation
GO:0006811	0.987	monoatomic ion transport
GO:0009987	0.986	cellular process
GO:0050789	0.976	regulation of biological process
GO:0006812	0.975	monoatomic cation transport
GO:0006816	0.953	calcium ion transport
GO:0050794	0.927	regulation of cellular process
GO:0065008	0.905	regulation of biological quality
GO:0050896	0.853	response to stimulus
GO:0007204	0.826	positive regulation of cytosolic calcium ion concentration
GO:0032501	0.669	multicellular organismal process
GO:0007154	0.551	cell communication
GO:0023052	0.474	signaling
GO:0051716	0.399	cellular response to stimulus
GO:0055085	0.398	transmembrane transport
GO:0007267	0.384	cell-cell signaling
GO:0034220	0.343	monoatomic ion transmembrane transport
GO:0098662	0.303	inorganic cation transmembrane transport
GO:0098655	0.302	monoatomic cation transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098797	0.996	plasma membrane protein complex
GO:0034702	0.995	ion channel complex
GO:0034703	0.994	cation channel complex
GO:0005891	0.977	voltage-gated calcium channel complex
GO:0005622	0.822	intracellular anatomical structure
GO:0043226	0.741	organelle
GO:0043227	0.678	membrane-bounded organelle
GO:0042995	0.662	cell projection
GO:0045202	0.634	synapse
GO:0005737	0.502	cytoplasm
GO:0043231	0.431	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]