StarFunc result for job id O00562

User Input

>input (1244 residues)
MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGSGQYTH
KVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGG
QQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTA
AQTGPLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWTELSMAD
IRALEEETARMLAQRMAKCNTGSEGSEAQPPGKPSTEARSAASNTGTPDGPEAPPGPDAS
PDASFGKQWSSSSRSSYSSQHGGAVSPQSLSEWRMQNIARDSENSSEEEFFDAHEGFSDS
EEVFPKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELG
AEACAVHALFLILHSGNILDSGPGDANSKQADVQTLSSAFEAVTRIHFPEALGHVALRLV
PCPPICAAAYALVSNLSPYSHDGDSLSRSQDHIPLAALPLLATSSSRYQGAVATVIARTN
QAYSAFLRSPEGAGFCGQVALIGDGVGGILGFDALCHSANAGTGSRGSSRRGSMNNELLS
PEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAAPATTSSWEP
RRASTAFCPPAASSEAPDGPSSTARLDFKVSGFFLFGSPLGLVLALRKTVMPALEAAQMR
PACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLTVPRYQKFPLGDGSSLLLADTLQTHS
SLFLEELEMLVPSTPTSTSGAFWKGSELATDPPAQPAAPSTTSEVVKILERWWGTKRIDY
SLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEKERPQLAECEEPSIYSPAFP
REKWQRKRTQVKIRNVTSNHRASDTVVCEGRPQVLSGRFMYGPLDVVTLTGEKVDVYIMT
QPLSGKWIHFGTEVTNSSGRLTFPVPPERALGIGVYPVRMVVRGDHTYAECCLTVVARGT
EAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWL
SQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPS
QTYIVGRAVRKLQAQCQFLSDGYVAHLGQLEAGSHSHASSGPPRAALGKSSYGVAAPVDF
LRKQSQLLRSRGPSQAEREGPGTPPTTLARGKARSISLKLDSEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R5I7	0.575	0.575	0.000	1244	1.000	1.000	A0A024R5I7.pdb.gz
2	AFDB:F1LXD6	0.490	0.478	0.000	1281	0.560	0.544	F1LXD6.pdb.gz	F1LXD6_RAT Phosphatidylinositol transfer protein, membrane-associated 2 OS=Rattus norvegicus OX=10116 GN=Pitpnm2 PE=1 SV=3
3	AFDB:P43125	0.533	0.527	0.000	1259	0.443	0.438	P43125.pdb.gz	RDGB_DROME Protein retinal degeneration B OS=Drosophila melanogaster OX=7227 GN=rdgB PE=1 SV=2
4	AFDB:Q9BZ72	0.545	0.508	0.000	1349	0.570	0.526	Q9BZ72.pdb.gz	PITM2_HUMAN Membrane-associated phosphatidylinositol transfer protein 2 OS=Homo sapiens OX=9606 GN=PITPNM2 PE=1 SV=1
5	AFDB:G5EED9	0.315	0.367	4.704E-99	1034	0.336	0.404	G5EED9.pdb.gz	G5EED9_CAEEL DDHD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pitp-1 PE=1 SV=1
6	AFDB:M0RDK4	0.519	0.690	3.514E-96	922	0.368	0.497	M0RDK4.pdb.gz	M0RDK4_RAT PITPNM family member 3 OS=Rattus norvegicus OX=10116 GN=Pitpnm3 PE=1 SV=3
7	AFDB:E7F006	0.516	0.664	1.716E-95	947	0.363	0.476	E7F006.pdb.gz	E7F006_DANRE Membrane-associated phosphatidylinositol transfer protein 3 OS=Danio rerio OX=7955 GN=pitpnm3 PE=3 SV=1
8	PDB:2a1lA	0.202	0.912	2.435E-29	269	0.092	0.428	2a1lA.pdb.gz
9	AFDB:Q802Z3	0.199	0.894	1.079E-28	270	0.096	0.441	Q802Z3.pdb.gz	Q802Z3_DANRE Phosphatidylinositol transfer protein, beta,-like OS=Danio rerio OX=7955 GN=zgc:55645 PE=1 SV=1
10	PDB:1uw5A	0.200	0.899	3.182E-28	269	0.100	0.461	1uw5A.pdb.gz	Structure-Function Analysis of Human [Corrected] Phosphatidylinositol Transfer Protein Alpha Bound to Phosphatidylinositol.
11	AFDB:A0A0B4KGG5	0.198	0.883	3.794E-28	273	0.089	0.407	A0A0B4KGG5.pdb.gz	A0A0B4KGG5_DROME Vibrator, isoform B OS=Drosophila melanogaster OX=7227 GN=vib PE=1 SV=1
12	AFDB:A0A0B4JD27	0.140	0.165	2.182E-9	1045	0.113	0.135	A0A0B4JD27.pdb.gz	A0A0B4JD27_DROME Lipin, isoform E OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
13	PDB:4s3pA	0.056	0.098	1.680E-4	691	0.019	0.035	4s3pA.pdb.gz
14	PDB:3l8eA	0.110	0.608	1.874E-4	185	0.018	0.124	3l8eA.pdb.gz	Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
15	PDB:3lpfA	0.104	0.175	5.908E-4	603	0.026	0.053	3lpfA.pdb.gz	Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
16	PDB:6hyjB	0.097	0.482	8.663E-4	223	0.021	0.117	6hyjB.pdb.gz	Crystal structures and snapshots along the reaction pathway of human phosphoserine phosphatase.
17	PDB:5it0A	0.100	0.281	1.078E-3	396	0.033	0.104	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
18	PDB:2ia5H	0.093	0.354	1.139E-3	301	0.018	0.073	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
19	PDB:4edqA	0.059	0.137	1.270E-3	483	0.019	0.050	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
20	PDB:1l9mB	0.070	0.111	1.417E-3	681	0.018	0.034	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZTJ8	0.0	677	958	0.272	0.353	A0A8I5ZTJ8_RAT PITPNM family member 3 OS=Rattus norvegicus OX=10116 GN=Pitpnm3 PE=3 SV=1
2	E7F006	0.0	826	947	0.360	0.473	E7F006_DANRE Membrane-associated phosphatidylinositol transfer protein 3 OS=Danio rerio OX=7955 GN=pitpnm3 PE=3 SV=1
3	F1LXD6	0.0	1334	1331	0.569	0.532	F1LXD6_RAT Phosphatidylinositol transfer protein, membrane-associated 2 OS=Rattus norvegicus OX=10116 GN=Pitpnm2 PE=1 SV=3
4	M0RDK4	0.0	864	974	0.381	0.487	M0RDK4_RAT PITPNM family member 3 OS=Rattus norvegicus OX=10116 GN=Pitpnm3 PE=1 SV=3
5	O00562	0.0	2558	1244	1.000	1.000	PITM1_HUMAN Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1 PE=1 SV=4
6	P43125	0.0	1022	1259	0.452	0.446	RDGB_DROME Protein retinal degeneration B OS=Drosophila melanogaster OX=7227 GN=rdgB PE=1 SV=2
7	Q5U2N3	0.0	2362	1242	0.934	0.936	PITM1_RAT Membrane-associated phosphatidylinositol transfer protein 1 OS=Rattus norvegicus OX=10116 GN=Pitpnm1 PE=1 SV=1
8	Q6ZPQ6	0.0	1343	1335	0.573	0.534	PITM2_MOUSE Membrane-associated phosphatidylinositol transfer protein 2 OS=Mus musculus OX=10090 GN=Pitpnm2 PE=1 SV=2
9	Q9BZ71	0.0	889	974	0.382	0.488	PITM3_HUMAN Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens OX=9606 GN=PITPNM3 PE=1 SV=2
10	Q9BZ72	0.0	1362	1349	0.585	0.540	PITM2_HUMAN Membrane-associated phosphatidylinositol transfer protein 2 OS=Homo sapiens OX=9606 GN=PITPNM2 PE=1 SV=1
11	G5EED9	6.11e-116	389	1034	0.195	0.235	G5EED9_CAEEL DDHD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pitp-1 PE=1 SV=1
12	Q9NCL7	3.34e-78	260	259	0.098	0.471	PITP2_DICDI Phosphatidylinositol transfer protein 2 OS=Dictyostelium discoideum OX=44689 GN=pitB PE=2 SV=1
13	P53810	1.45e-74	250	271	0.100	0.458	PIPNA_MOUSE Phosphatidylinositol transfer protein alpha isoform OS=Mus musculus OX=10090 GN=Pitpna PE=1 SV=2
14	P16446	1.93e-74	250	271	0.099	0.454	PIPNA_RAT Phosphatidylinositol transfer protein alpha isoform OS=Rattus norvegicus OX=10116 GN=Pitpna PE=1 SV=2
15	Q00169	1.35e-73	248	270	0.100	0.459	PIPNA_HUMAN Phosphatidylinositol transfer protein alpha isoform OS=Homo sapiens OX=9606 GN=PITPNA PE=1 SV=2
16	Q2HJ54	1.48e-72	244	270	0.098	0.452	PIPNA_BOVIN Phosphatidylinositol transfer protein alpha isoform OS=Bos taurus OX=9913 GN=PITPNA PE=1 SV=3
17	Q9NCL8	1.60e-70	239	264	0.091	0.428	PITP1_DICDI Phosphatidylinositol transfer protein 1 OS=Dictyostelium discoideum OX=44689 GN=pitA PE=1 SV=1
18	E7EZR3	2.02e-70	239	271	0.103	0.472	E7EZR3_DANRE Phosphatidylinositol transfer protein beta isoform isoform 2 OS=Danio rerio OX=7955 GN=zgc:56092 PE=1 SV=3
19	Q803U3	3.11e-70	238	271	0.098	0.450	Q803U3_DANRE Phosphatidylinositol transfer protein alpha isoform OS=Danio rerio OX=7955 GN=pitpna PE=1 SV=1
20	F1QRW4	3.44e-70	238	272	0.094	0.430	F1QRW4_DANRE Phosphatidylinositol transfer protein beta isoform isoform 1 OS=Danio rerio OX=7955 GN=zgc:56092 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03767 Acid_phosphat_B	3.3e+02	12.2	HAD superfamily, subfamily IIIB (Acid phosphatase)
2	PF02862 DDHD	2.6e-41	153.9	DDHD domain
3	PF02121 IP_trans	2.6e-103	356.5	Phosphatidylinositol transfer protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348772

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417175	0.975	Vesicle-associated membrane protein-associated protein B/C
2	9606.ENSP00000345656	0.924	Vesicle-associated membrane protein-associated protein A
3	9606.ENSP00000380638	0.891	Protein-tyrosine kinase 2-beta
4	9606.ENSP00000300093	0.849	Serine/threonine-protein kinase PLK1
5	9606.ENSP00000369862	0.836	Collagen type IV alpha-3-binding protein
6	9606.ENSP00000420295	0.809	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
7	9606.ENSP00000257627	0.802	Putative oncomodulin-2
8	9606.ENSP00000263847	0.796	Oxysterol-binding protein 1
9	9606.ENSP00000242104	0.784	Oncomodulin-1
10	9606.ENSP00000482885	0.760	Phosphatidylinositol phosphatase PTPRQ
11	9606.ENSP00000283228	0.753	Receptor-type tyrosine-protein phosphatase R
12	9606.ENSP00000251527	0.742	Extended synaptotagmin-2
13	9606.ENSP00000304783	0.710	Prestin
14	9606.ENSP00000267113	0.692	Extended synaptotagmin-1
15	9606.ENSP00000262340	0.681	Retinoid isomerohydrolase
16	9606.ENSP00000373713	0.671	Phosphatidylinositide phosphatase SAC1
17	9606.ENSP00000359357	0.670	Zinc finger protein Gfi-1
18	9606.ENSP00000482504	0.632	Photoreceptor-specific nuclear receptor
19	9606.ENSP00000398596	0.628	Phosphatidate cytidylyltransferase, mitochondrial
20	9606.ENSP00000324960	0.618	Calcium-binding protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008526	0.999	phosphatidylinositol transfer activity
GO:0043167	0.998	ion binding
GO:0035091	0.979	phosphatidylinositol binding
GO:0043169	0.970	cation binding
GO:0030971	0.963	receptor tyrosine kinase binding
GO:0005509	0.957	calcium ion binding
GO:0008525	0.869	phosphatidylcholine transporter activity
GO:0043168	0.497	anion binding
GO:0070300	0.409	phosphatidic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:1901576	0.996	organic substance biosynthetic process
GO:0050794	0.988	regulation of cellular process
GO:0006644	0.988	phospholipid metabolic process
GO:0023052	0.984	signaling
GO:0007154	0.984	cell communication
GO:0051716	0.984	cellular response to stimulus
GO:0051179	0.975	localization
GO:0006650	0.967	glycerophospholipid metabolic process
GO:0044249	0.966	cellular biosynthetic process
GO:0007165	0.966	signal transduction
GO:0033036	0.961	macromolecule localization
GO:0090407	0.954	organophosphate biosynthetic process
GO:0046488	0.945	phosphatidylinositol metabolic process
GO:0006810	0.930	transport
GO:0008654	0.899	phospholipid biosynthetic process
GO:0010876	0.894	lipid localization
GO:0046474	0.836	glycerophospholipid biosynthetic process
GO:0032501	0.830	multicellular organismal process
GO:0071702	0.813	organic substance transport
GO:0051606	0.808	detection of stimulus
GO:0006661	0.763	phosphatidylinositol biosynthetic process
GO:0006869	0.738	lipid transport
GO:0009581	0.709	detection of external stimulus
GO:0015748	0.620	organophosphate ester transport
GO:0009582	0.612	detection of abiotic stimulus
GO:0032502	0.515	developmental process
GO:0015914	0.510	phospholipid transport
GO:0009314	0.448	response to radiation
GO:0048856	0.428	anatomical structure development
GO:0009416	0.345	response to light stimulus
GO:0007275	0.322	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.995	cytosol
GO:0016020	0.994	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]