StarFunc result for job id O00570

User Input

>input (391 residues)
MYSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRVKRPMNAFMV
WSRGQRRKMAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKY
RPRRKTKTLLKKDKYSLAGGLLAAGAGGGGAAVAMGVGVGVGAAAVGQRLESPGGAAGGG
YAHVNGWANGAYPGSVAAAAAAAAMMQEAQLAYGQHPGAGGAHPHAHPAHPHPHHPHAHP
HNPQPMHRYDMGALQYSPISNSQGYMSASPSGYGGLPYGAAAAAAAAAGGAHQNSAVAAA
AAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAA
AAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00570	0.999	0.999	1.012E-51	391	1.000	1.000	O00570.pdb.gz	SOX1_HUMAN Transcription factor SOX-1 OS=Homo sapiens OX=9606 GN=SOX1 PE=1 SV=2
2	AFDB:Q6DGL6	0.477	0.544	2.167E-36	336	0.711	0.827	Q6DGL6.pdb.gz	SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio OX=7955 GN=sox1a PE=2 SV=2
3	AFDB:Q2PG84	0.384	0.383	3.353E-35	393	0.754	0.751	Q2PG84.pdb.gz	SOX1_XENLA Transcription factor Sox-1 OS=Xenopus laevis OX=8355 GN=sox1 PE=2 SV=1
4	AFDB:Q2Z1R2	0.396	0.450	1.959E-34	340	0.711	0.818	Q2Z1R2.pdb.gz	SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio OX=7955 GN=sox1b PE=2 SV=1
5	AFDB:P41225	0.339	0.302	3.426E-21	446	0.575	0.504	P41225.pdb.gz	SOX3_HUMAN Transcription factor SOX-3 OS=Homo sapiens OX=9606 GN=SOX3 PE=1 SV=2
6	AFDB:Q9VLH8	0.287	0.206	1.570E-14	572	0.353	0.241	Q9VLH8.pdb.gz	Q9VLH8_DROME LD44245p OS=Drosophila melanogaster OX=7227 GN=SoxN PE=1 SV=1
7	AFDB:Q9W7R5	0.221	0.304	1.349E-11	280	0.325	0.454	Q9W7R5.pdb.gz	SOX21_CHICK Transcription factor SOX-21 OS=Gallus gallus OX=9031 GN=SOX21 PE=2 SV=1
8	AFDB:Q9H6I2	0.227	0.215	4.286E-11	414	0.281	0.266	Q9H6I2.pdb.gz	SOX17_HUMAN Transcription factor SOX-17 OS=Homo sapiens OX=9606 GN=SOX17 PE=1 SV=1
9	AFDB:Q9VUD1	0.240	0.242	6.176E-11	388	0.292	0.294	Q9VUD1.pdb.gz	Q9VUD1_DROME IP01552p OS=Drosophila melanogaster OX=7227 GN=Sox21a PE=2 SV=1
10	AFDB:P0C1G9	0.221	0.218	1.135E-10	395	0.281	0.278	P0C1G9.pdb.gz	SOX11_RAT Transcription factor SOX-11 OS=Rattus norvegicus OX=10116 GN=Sox11 PE=2 SV=1
11	PDB:1j5nA	0.162	0.619	1.402E-2	93	0.049	0.204	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.117	0.102	1.717	451	0.026	0.022	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:5x62B	0.067	0.067	2.795	387	0.031	0.031	5x62B.pdb.gz	Substrate Recognition Mechanism of the Putative Yeast Carnosine N-methyltransferase
14	PDB:7fbyA	0.064	0.137	3.354	153	0.041	0.105	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:4bwrA	0.082	0.072	3.789	467	0.026	0.021	4bwrA.pdb.gz	Crystal Structure of C5321: A Protective Antigen Present in Uropathogenic Escherichia Coli Strains Displaying an Slr Fold.
16	PDB:5lj5O	0.079	0.101	3.789	283	0.054	0.074	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
17	PDB:3ux9A	0.091	0.195	6.165	132	0.026	0.076	3ux9A.pdb.gz
18	PDB:1lotA	0.075	0.067	6.552	436	0.013	0.011	1lotA.pdb.gz	Crystal structure of the complex between actin and human vitamin D-binding protein at 2.5 A resolution.
19	PDB:3dv0E	0.075	0.084	6.552	344	0.026	0.029	3dv0E.pdb.gz	Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multienzyme complex
20	PDB:2cyyA	0.065	0.154	7.864	151	0.036	0.093	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00570	0.0	756	391	1.000	1.000	SOX1_HUMAN Transcription factor SOX-1 OS=Homo sapiens OX=9606 GN=SOX1 PE=1 SV=2
2	P53783	0.0	755	391	0.995	0.995	SOX1_MOUSE Transcription factor SOX-1 OS=Mus musculus OX=10090 GN=Sox1 PE=2 SV=2
3	Q2Z1R2	7.83e-142	409	340	0.688	0.791	SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio OX=7955 GN=sox1b PE=2 SV=1
4	Q6DGL6	5.93e-140	404	336	0.698	0.812	SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio OX=7955 GN=sox1a PE=2 SV=2
5	Q2PG84	1.52e-126	372	393	0.708	0.705	SOX1_XENLA Transcription factor Sox-1 OS=Xenopus laevis OX=8355 GN=sox1 PE=2 SV=1
6	P48430	6.42e-111	329	315	0.522	0.648	SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus OX=9031 GN=SOX2 PE=1 SV=1
7	O42569	1.31e-103	310	311	0.478	0.601	SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis OX=8355 GN=sox2 PE=1 SV=1
8	D4A543	4.94e-103	309	319	0.519	0.636	D4A543_RAT SRY-box transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Sox2 PE=4 SV=1
9	Q60I23	4.94e-103	309	319	0.519	0.636	Q60I23_MOUSE SRY (sex determining region Y)-box 2 OS=Mus musculus OX=10090 GN=Sox2 PE=1 SV=1
10	Q9PSV6	6.61e-103	308	316	0.542	0.671	Q9PSV6_CHICK SOX3 OS=Gallus gallus OX=9031 GN=Sox3 PE=2 SV=1
11	Q6EJB7	4.34e-102	306	300	0.494	0.643	SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio OX=7955 GN=sox3 PE=1 SV=1
12	A0A0U3FYV6	6.62e-102	306	317	0.512	0.631	A0A0U3FYV6_HUMAN SRY (Sex determining region Y)-box 2 OS=Homo sapiens OX=9606 GN=SOX2 PE=4 SV=1
13	P48431	6.62e-102	306	317	0.512	0.631	SOX2_HUMAN Transcription factor SOX-2 OS=Homo sapiens OX=9606 GN=SOX2 PE=1 SV=1
14	P48433	2.33e-101	305	312	0.509	0.638	SOX3_CHICK Transcription factor SOX-3 OS=Gallus gallus OX=9031 GN=SOX3 PE=2 SV=1
15	P55863	3.37e-101	304	309	0.499	0.631	SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis OX=8355 GN=sox3-a PE=1 SV=1
16	Q6P0E1	8.60e-101	303	315	0.483	0.600	SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio OX=7955 GN=sox2 PE=2 SV=1
17	P48432	2.64e-99	300	319	0.509	0.624	SOX2_MOUSE Transcription factor SOX-2 OS=Mus musculus OX=10090 GN=Sox2 PE=1 SV=2
18	P53784	4.87e-93	285	375	0.527	0.549	SOX3_MOUSE Transcription factor SOX-3 OS=Mus musculus OX=10090 GN=Sox3 PE=1 SV=2
19	P41225	1.46e-92	286	446	0.519	0.455	SOX3_HUMAN Transcription factor SOX-3 OS=Homo sapiens OX=9606 GN=SOX3 PE=1 SV=2
20	Q9DDD7	5.44e-63	205	292	0.412	0.551	SX19B_DANRE Transcription factor Sox-19b OS=Danio rerio OX=7955 GN=sox19b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19990 DUF6426	8.4e+02	10.8	Family of unknown function (DUF6426)
2	PF00505 HMG_box	1.2e-23	94.6	HMG (high mobility group) box
3	PF09011 HMG_box_2	1.3e-07	43.4	HMG-box domain
4	PF12336 SOXp	9.2e-27	105.2	SOX transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330218

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000404100	0.878	Paired box protein Pax-6
2	9606.ENSP00000357206	0.826	Nestin
3	9606.ENSP00000259915	0.805	POU domain, class 5, transcription factor 1
4	9606.ENSP00000344456	0.780	Catenin beta-1
5	9606.ENSP00000229307	0.775	Homeobox protein NANOG
6	9606.ENSP00000343819	0.737	Homeobox protein OTX2
7	9606.ENSP00000400341	0.732	Hepatocyte nuclear factor 3-beta
8	9606.ENSP00000317333	0.698	Neurogenin-2
9	9606.ENSP00000334458	0.692	Transcription factor GATA-4
10	9606.ENSP00000339004	0.689	Forkhead box protein G1
11	9606.ENSP00000329170	0.681	POU domain, class 3, transcription factor 2
12	9606.ENSP00000442439	0.677	Homeobox protein MIXL1
13	9606.ENSP00000435509	0.674	Zinc finger protein ZIC 4
14	9606.ENSP00000269216	0.668	Transcription factor GATA-6
15	9606.ENSP00000331040	0.654	Oligodendrocyte transcription factor 2
16	9606.ENSP00000363804	0.654	Krueppel-like factor 4
17	9606.ENSP00000468500	0.651	Glial fibrillary acidic protein
18	9606.ENSP00000264498	0.649	Fibroblast growth factor 2
19	9606.ENSP00000288699	0.642	Dihydropyrimidinase-related protein 5
20	9606.ENSP00000348602	0.632	Amphiphysin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.999	transcription regulator activity
GO:0003700	0.988	DNA-binding transcription factor activity
GO:0000981	0.814	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.996	developmental process
GO:0032501	0.995	multicellular organismal process
GO:0007275	0.993	multicellular organism development
GO:0050794	0.989	regulation of cellular process
GO:0010468	0.979	regulation of gene expression
GO:0010556	0.976	regulation of macromolecule biosynthetic process
GO:0019219	0.975	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.974	regulation of cellular biosynthetic process
GO:0051252	0.970	regulation of RNA metabolic process
GO:0006355	0.964	regulation of DNA-templated transcription
GO:0007399	0.959	nervous system development
GO:0009987	0.952	cellular process
GO:0010604	0.878	positive regulation of macromolecule metabolic process
GO:0031325	0.868	positive regulation of cellular metabolic process
GO:0051254	0.859	positive regulation of RNA metabolic process
GO:0010557	0.846	positive regulation of macromolecule biosynthetic process
GO:0031328	0.842	positive regulation of cellular biosynthetic process
GO:1902680	0.829	positive regulation of RNA biosynthetic process
GO:1903508	0.776	positive regulation of nucleic acid-templated transcription
GO:0048513	0.773	animal organ development
GO:0006357	0.765	regulation of transcription by RNA polymerase II
GO:0045893	0.679	positive regulation of DNA-templated transcription
GO:0009653	0.614	anatomical structure morphogenesis
GO:0030154	0.597	cell differentiation
GO:0050896	0.500	response to stimulus
GO:0048519	0.486	negative regulation of biological process
GO:0048523	0.465	negative regulation of cellular process
GO:0045944	0.456	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.966	intracellular organelle lumen
GO:0031981	0.940	nuclear lumen
GO:0005654	0.692	nucleoplasm
GO:0032991	0.489	protein-containing complex
GO:0005667	0.421	transcription regulator complex
GO:0005737	0.316	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]