StarFunc result for job id O00585

User Input

>input (134 residues)
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
GCKRTERSQTPKGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00585	1.000	1.000	6.699E-24	134	1.000	1.000	O00585.pdb.gz	CCL21_HUMAN C-C motif chemokine 21 OS=Homo sapiens OX=9606 GN=CCL21 PE=1 SV=1
2	AFDB:P84444	0.566	0.569	5.755E-16	133	0.701	0.707	P84444.pdb.gz	CC21A_MOUSE C-C motif chemokine 21a OS=Mus musculus OX=10090 GN=Ccl21a PE=1 SV=1
3	PDB:2l4nA	0.428	0.747	4.051E-10	70	0.515	0.986	2l4nA.pdb.gz
4	AFDB:P48298	0.426	0.574	2.944E-8	97	0.246	0.340	P48298.pdb.gz	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
5	AFDB:P13500	0.429	0.566	4.634E-8	99	0.276	0.374	P13500.pdb.gz	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
6	AFDB:P51671	0.433	0.583	6.835E-8	97	0.254	0.351	P51671.pdb.gz	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
7	AFDB:A2BIR2	0.452	0.506	7.292E-8	119	0.276	0.311	A2BIR2.pdb.gz	A2BIR2_DANRE C-C motif chemokine OS=Danio rerio OX=7955 GN=ccl-c5a PE=3 SV=1
8	AFDB:P80098	0.418	0.555	7.292E-8	99	0.254	0.343	P80098.pdb.gz	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
9	AFDB:Q99731	0.469	0.625	1.806E-7	98	0.261	0.357	Q99731.pdb.gz	CCL19_HUMAN C-C motif chemokine 19 OS=Homo sapiens OX=9606 GN=CCL19 PE=1 SV=1
10	AFDB:D4ABS1	0.430	0.577	2.340E-7	98	0.261	0.357	D4ABS1.pdb.gz	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
11	AFDB:P10148	0.434	0.395	2.664E-7	148	0.246	0.223	P10148.pdb.gz	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
12	PDB:1bo0A	0.412	0.679	2.096E-6	76	0.201	0.355	1bo0A.pdb.gz
13	PDB:2mp1A	0.431	0.706	2.622E-5	77	0.179	0.312	2mp1A.pdb.gz
14	PDB:2mpmA	0.421	0.706	2.622E-5	74	0.201	0.365	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
15	PDB:1esrA	0.403	0.682	2.985E-5	76	0.179	0.316	1esrA.pdb.gz
16	PDB:2ra4B	0.384	0.756	4.697E-5	65	0.179	0.369	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
17	PDB:1hhvA	0.374	0.642	5.705E-5	74	0.187	0.338	1hhvA.pdb.gz
18	PDB:1j8iA	0.399	0.548	5.705E-5	93	0.149	0.215	1j8iA.pdb.gz
19	PDB:4zltF	0.404	0.823	6.929E-5	62	0.179	0.387	4zltF.pdb.gz
20	PDB:7f1qR	0.413	0.155	7.887E-5	367	0.164	0.060	7f1qR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00585	8.98e-94	268	134	1.000	1.000	CCL21_HUMAN C-C motif chemokine 21 OS=Homo sapiens OX=9606 GN=CCL21 PE=1 SV=1
2	P86792	1.21e-46	149	133	0.709	0.714	CC21B_MOUSE C-C motif chemokine 21b OS=Mus musculus OX=10090 GN=Ccl21b PE=1 SV=1
3	P84444	1.15e-45	146	133	0.701	0.707	CC21A_MOUSE C-C motif chemokine 21a OS=Mus musculus OX=10090 GN=Ccl21a PE=1 SV=1
4	A0A2R8QR67	1.90e-16	71.6	102	0.254	0.333	A0A2R8QR67_DANRE C-C motif chemokine 21-like OS=Danio rerio OX=7955 GN=ccl25a PE=4 SV=1
5	O70460	1.22e-13	64.3	108	0.269	0.333	CCL19_MOUSE C-C motif chemokine 19 OS=Mus musculus OX=10090 GN=Ccl19 PE=1 SV=1
6	A9ZPF5	1.61e-11	59.3	119	0.299	0.336	A9ZPF5_DANRE C-C motif chemokine OS=Danio rerio OX=7955 GN=ccl-c5a PE=2 SV=1
7	P13236	3.49e-11	57.8	92	0.261	0.380	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
8	P48298	1.12e-10	56.6	97	0.254	0.351	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
9	Q99731	1.51e-10	56.2	98	0.201	0.276	CCL19_HUMAN C-C motif chemokine 19 OS=Homo sapiens OX=9606 GN=CCL19 PE=1 SV=1
10	P50230	2.67e-10	55.5	92	0.276	0.402	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
11	A2BIR2	6.22e-10	55.1	119	0.261	0.294	A2BIR2_DANRE C-C motif chemokine OS=Danio rerio OX=7955 GN=ccl-c5a PE=3 SV=1
12	O89093	6.33e-10	54.7	97	0.216	0.299	CCL20_MOUSE C-C motif chemokine 20 OS=Mus musculus OX=10090 GN=Ccl20 PE=1 SV=1
13	P80098	6.84e-10	54.7	99	0.187	0.253	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
14	F1QBE9	7.59e-10	54.7	106	0.209	0.264	F1QBE9_DANRE Chemokine (C-C motif) ligand 25b OS=Danio rerio OX=7955 GN=ccl25b PE=4 SV=1
15	P10147	2.60e-09	52.8	92	0.239	0.348	CCL3_HUMAN C-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CCL3 PE=1 SV=1
16	O15467	5.06e-09	52.8	120	0.164	0.183	CCL16_HUMAN C-C motif chemokine 16 OS=Homo sapiens OX=9606 GN=CCL16 PE=1 SV=1
17	P78556	5.69e-09	52.0	96	0.216	0.302	CCL20_HUMAN C-C motif chemokine 20 OS=Homo sapiens OX=9606 GN=CCL20 PE=1 SV=1
18	Q4KS30	6.14e-09	51.6	89	0.216	0.326	Q4KS30_CHICK Chemokine K203 OS=Gallus gallus OX=9031 PE=4 SV=1
19	P97545	7.35e-09	51.6	97	0.194	0.268	CCL11_RAT Eotaxin OS=Rattus norvegicus OX=10116 GN=Ccl11 PE=3 SV=1
20	D4ABS1	9.50e-09	51.6	98	0.216	0.296	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	8.1e-18	75.7	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246657	0.999	C-C chemokine receptor type 7
2	9606.ENSP00000362795	0.994	C-X-C chemokine receptor type 3
3	9606.ENSP00000294489	0.978	Podoplanin
4	9606.ENSP00000249887	0.952	Atypical chemokine receptor 4
5	9606.ENSP00000386884	0.925	C-X-C chemokine receptor type 4
6	9606.ENSP00000308815	0.919	C-C motif chemokine 19
7	9606.ENSP00000292303	0.899	C-C chemokine receptor type 5
8	9606.ENSP00000286758	0.897	C-X-C motif chemokine 13
9	9606.ENSP00000292174	0.886	C-X-C chemokine receptor type 5
10	9606.ENSP00000292301	0.878	C-C chemokine receptor type 2
11	9606.ENSP00000379140	0.876	Stromal cell-derived factor 1
12	9606.ENSP00000343952	0.866	Chemokine (C-C motif) receptor 6
13	9606.ENSP00000351059	0.849	CX3C chemokine receptor 1
14	9606.ENSP00000296140	0.840	C-C chemokine receptor type 1
15	9606.ENSP00000350256	0.820	C-C chemokine receptor type 9
16	9606.ENSP00000319635	0.813	C-X-C chemokine receptor type 2
17	9606.ENSP00000354901	0.811	C-X-C motif chemokine 9
18	9606.ENSP00000295683	0.810	C-X-C chemokine receptor type 1
19	9606.ENSP00000441600	0.808	C-C chemokine receptor type 3
20	9606.ENSP00000326432	0.803	C-C chemokine receptor type 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.502	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0048518	0.980	positive regulation of biological process
GO:0002376	0.974	immune system process
GO:0007154	0.974	cell communication
GO:0009605	0.968	response to external stimulus
GO:0019222	0.964	regulation of metabolic process
GO:0051716	0.957	cellular response to stimulus
GO:0048583	0.953	regulation of response to stimulus
GO:0042221	0.950	response to chemical
GO:0032501	0.949	multicellular organismal process
GO:0042330	0.946	taxis
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0009893	0.943	positive regulation of metabolic process
GO:0048522	0.942	positive regulation of cellular process
GO:0006935	0.941	chemotaxis
GO:0040017	0.933	positive regulation of locomotion
GO:0006950	0.924	response to stress
GO:0010604	0.922	positive regulation of macromolecule metabolic process
GO:0007165	0.922	signal transduction
GO:0010033	0.918	response to organic substance
GO:0050900	0.914	leukocyte migration
GO:0030335	0.913	positive regulation of cell migration
GO:0002684	0.903	positive regulation of immune system process
GO:0006952	0.898	defense response
GO:0071674	0.897	mononuclear cell migration
GO:0048584	0.894	positive regulation of response to stimulus
GO:0071677	0.893	positive regulation of mononuclear cell migration
GO:0050921	0.881	positive regulation of chemotaxis
GO:0048523	0.878	negative regulation of cellular process
GO:0061844	0.878	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0030595	0.874	leukocyte chemotaxis
GO:0030155	0.861	regulation of cell adhesion
GO:0007166	0.853	cell surface receptor signaling pathway
GO:0045785	0.852	positive regulation of cell adhesion
GO:0002690	0.845	positive regulation of leukocyte chemotaxis
GO:0019220	0.792	regulation of phosphate metabolic process
GO:0044093	0.789	positive regulation of molecular function
GO:0080090	0.776	regulation of primary metabolic process
GO:1902533	0.776	positive regulation of intracellular signal transduction
GO:0051171	0.771	regulation of nitrogen compound metabolic process
GO:0051130	0.769	positive regulation of cellular component organization
GO:0001775	0.766	cell activation
GO:2000401	0.762	regulation of lymphocyte migration
GO:0001906	0.744	cell killing
GO:0032879	0.744	regulation of localization
GO:0034097	0.741	response to cytokine
GO:0016043	0.738	cellular component organization
GO:2000403	0.735	positive regulation of lymphocyte migration
GO:0065008	0.728	regulation of biological quality
GO:0051246	0.724	regulation of protein metabolic process
GO:0050790	0.696	regulation of catalytic activity
GO:0071622	0.661	regulation of granulocyte chemotaxis
GO:0051282	0.642	regulation of sequestering of calcium ion
GO:0043254	0.635	regulation of protein-containing complex assembly
GO:0033043	0.607	regulation of organelle organization
GO:0051179	0.604	localization
GO:0022407	0.598	regulation of cell-cell adhesion
GO:1902622	0.595	regulation of neutrophil migration
GO:0031325	0.592	positive regulation of cellular metabolic process
GO:0051173	0.578	positive regulation of nitrogen compound metabolic process
GO:2000404	0.574	regulation of T cell migration
GO:0051247	0.573	positive regulation of protein metabolic process
GO:0071345	0.563	cellular response to cytokine stimulus
GO:0048856	0.561	anatomical structure development
GO:0051336	0.545	regulation of hydrolase activity
GO:0030833	0.532	regulation of actin filament polymerization
GO:0006954	0.521	inflammatory response
GO:0080134	0.508	regulation of response to stress
GO:0044089	0.505	positive regulation of cellular component biogenesis
GO:0010941	0.493	regulation of cell death
GO:0045321	0.484	leukocyte activation
GO:0042981	0.482	regulation of apoptotic process
GO:0051239	0.453	regulation of multicellular organismal process
GO:0010468	0.438	regulation of gene expression
GO:0042127	0.429	regulation of cell population proliferation
GO:0006810	0.428	transport
GO:0033628	0.414	regulation of cell adhesion mediated by integrin
GO:0060491	0.411	regulation of cell projection assembly
GO:0051240	0.407	positive regulation of multicellular organismal process
GO:0120032	0.381	regulation of plasma membrane bounded cell projection assembly
GO:1903037	0.376	regulation of leukocyte cell-cell adhesion
GO:0007186	0.372	G protein-coupled receptor signaling pathway
GO:0031399	0.370	regulation of protein modification process
GO:0009889	0.334	regulation of biosynthetic process
GO:0033993	0.305	response to lipid
GO:0007267	0.300	cell-cell signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.762	cell periphery
GO:0005886	0.729	plasma membrane
GO:0005622	0.625	intracellular anatomical structure
GO:0005737	0.486	cytoplasm
GO:0043226	0.415	organelle
GO:0043227	0.414	membrane-bounded organelle
GO:0005615	0.389	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]