StarFunc result for job id O00587

User Input

>input (321 residues)
MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAV
KTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALS
CKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASE
PQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIE
CKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSR
FRSLHCLLYPDTPWCPQLGAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00587	1.000	1.000	4.535E-71	321	1.000	1.000	O00587.pdb.gz	MFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Homo sapiens OX=9606 GN=MFNG PE=1 SV=2
2	AFDB:O09008	0.849	0.849	3.340E-58	321	0.829	0.829	O09008.pdb.gz	MFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Mus musculus OX=10090 GN=Mfng PE=1 SV=1
3	AFDB:Q8JHF2	0.828	0.711	2.782E-45	374	0.539	0.463	Q8JHF2.pdb.gz	LFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Danio rerio OX=7955 GN=lfng PE=2 SV=2
4	AFDB:O09010	0.830	0.706	3.145E-45	378	0.545	0.463	O09010.pdb.gz	LFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Mus musculus OX=10090 GN=Lfng PE=1 SV=1
5	AFDB:Q8NES3	0.828	0.703	7.437E-45	379	0.558	0.472	Q8NES3.pdb.gz	LFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Homo sapiens OX=9606 GN=LFNG PE=1 SV=2
6	AFDB:Q9R1U9	0.811	0.780	3.361E-43	334	0.536	0.515	Q9R1U9.pdb.gz	RFNG_RAT Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Rattus norvegicus OX=10116 GN=Rfng PE=2 SV=1
7	AFDB:Q6KFX9	0.828	0.735	6.215E-43	362	0.520	0.461	Q6KFX9.pdb.gz	RFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Danio rerio OX=7955 GN=rfng PE=2 SV=1
8	AFDB:Q24342	0.803	0.629	1.443E-37	412	0.399	0.311	Q24342.pdb.gz	FNG_DROME Fringe glycosyltransferase OS=Drosophila melanogaster OX=7227 GN=fng PE=1 SV=1
9	AFDB:Q6Y288	0.469	0.309	2.153E-12	498	0.146	0.094	Q6Y288.pdb.gz	B3GLT_HUMAN Beta-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=B3GLCT PE=1 SV=2
10	AFDB:A0A068F9P7	0.510	0.341	2.588E-12	496	0.159	0.103	A0A068F9P7.pdb.gz	A0A068F9P7_DANRE Beta-1,3-glucosyltransferase OS=Danio rerio OX=7955 GN=b3galtla PE=2 SV=1
11	PDB:7jhiC	0.432	0.420	2.653E-8	331	0.140	0.136	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:4fixA	0.374	0.207	5.242E-6	629	0.115	0.059	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
13	PDB:7sckB	0.366	0.220	2.849E-4	598	0.118	0.064	7sckB.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
14	PDB:7sckA	0.290	0.174	4.659E-4	642	0.106	0.053	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
15	PDB:2gamC	0.398	0.349	4.954E-4	374	0.062	0.053	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
16	PDB:3r2wC	0.298	0.227	5.268E-4	450	0.075	0.053	3r2wC.pdb.gz
17	PDB:7au2A	0.348	0.182	5.958E-4	686	0.087	0.041	7au2A.pdb.gz
18	PDB:2xwnB	0.334	0.445	6.335E-4	227	0.090	0.128	2xwnB.pdb.gz	Structural and Functional Studies on Mycobacterial Ispd Enzymes
19	PDB:4y63A	0.348	0.386	9.161E-4	282	0.097	0.110	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
20	PDB:6fxrA	0.342	0.175	1.102E-3	700	0.093	0.043	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00587	0.0	659	321	1.000	1.000	MFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Homo sapiens OX=9606 GN=MFNG PE=1 SV=2
2	O09008	0.0	547	321	0.829	0.829	MFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Mus musculus OX=10090 GN=Mfng PE=1 SV=1
3	Q8JHF2	6.27e-131	379	374	0.523	0.449	LFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Danio rerio OX=7955 GN=lfng PE=2 SV=2
4	Q8NES3	3.88e-123	360	379	0.551	0.467	LFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Homo sapiens OX=9606 GN=LFNG PE=1 SV=2
5	O09010	5.11e-120	352	378	0.539	0.458	LFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Mus musculus OX=10090 GN=Lfng PE=1 SV=1
6	Q9R1U9	3.07e-110	325	334	0.495	0.476	RFNG_RAT Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Rattus norvegicus OX=10116 GN=Rfng PE=2 SV=1
7	O09009	9.96e-110	324	332	0.492	0.476	RFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Mus musculus OX=10090 GN=Rfng PE=2 SV=1
8	Q6KFX9	3.60e-104	311	362	0.477	0.423	RFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Danio rerio OX=7955 GN=rfng PE=2 SV=1
9	Q24342	7.16e-84	261	412	0.408	0.318	FNG_DROME Fringe glycosyltransferase OS=Drosophila melanogaster OX=7227 GN=fng PE=1 SV=1
10	A0A068F5P3	2.74e-06	50.8	493	0.174	0.114	A0A068F5P3_DANRE Beta-1,3-glucosyltransferase precursor OS=Danio rerio OX=7955 GN=si:dkey-189i22.3 PE=2 SV=1
11	Q6Y288	0.002	42.4	498	0.146	0.094	B3GLT_HUMAN Beta-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=B3GLCT PE=1 SV=2
12	A0A068F9P7	0.014	39.3	496	0.165	0.107	A0A068F9P7_DANRE Beta-1,3-glucosyltransferase OS=Danio rerio OX=7955 GN=b3galtla PE=2 SV=1
13	F4HU33	0.040	38.1	478	0.072	0.048	F4HU33_ARATH Glycosyltransferase OS=Arabidopsis thaliana OX=3702 GN=At1g01570 PE=1 SV=1
14	O74393	0.47	34.7	648	0.078	0.039	MAK5_SCHPO ATP-dependent RNA helicase mak5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mak5 PE=1 SV=1
15	F4JJF6	0.48	34.7	488	0.106	0.070	F4JJF6_ARATH Glycosyltransferase OS=Arabidopsis thaliana OX=3702 GN=DL3665C PE=1 SV=1
16	Q5DTK1	0.52	34.7	884	0.121	0.044	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3
17	Q70JA7	0.73	34.3	882	0.065	0.024	CHSS3_HUMAN Chondroitin sulfate synthase 3 OS=Homo sapiens OX=9606 GN=CHSY3 PE=2 SV=3
18	Q6P296	1.0	33.9	801	0.062	0.025	Q6P296_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=chys1 PE=2 SV=1
19	D3ZRM3	1.2	33.5	799	0.069	0.028	D3ZRM3_RAT Hexosyltransferase OS=Rattus norvegicus OX=10116 GN=Chsy1 PE=3 SV=3
20	Q6ZQ11	1.3	33.5	800	0.069	0.028	CHSS1_MOUSE Chondroitin sulfate synthase 1 OS=Mus musculus OX=10090 GN=Chsy1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02434 Fringe	1.4e-108	373.7	Fringe-like
2	PF01762 Galactosyl_T	5.7e+02	11.7	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.976	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000256646	0.970	Neurogenic locus notch homolog protein 2
3	9606.ENSP00000263388	0.958	Neurogenic locus notch homolog protein 3
4	9606.ENSP00000364163	0.939	Neurogenic locus notch homolog protein 4
5	9606.ENSP00000254958	0.820	Protein jagged-1
6	9606.ENSP00000222725	0.814	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
7	9606.ENSP00000307971	0.810	Beta-1,3-N-acetylglucosaminyltransferase radical fringe
8	9606.ENSP00000355718	0.778	Delta-like protein 1
9	9606.ENSP00000328169	0.737	Protein jagged-2
10	9606.ENSP00000364902	0.711	GDP-fucose protein O-fucosyltransferase 1
11	9606.ENSP00000319636	0.659	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
12	9606.ENSP00000316173	0.654	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
13	9606.ENSP00000249749	0.601	Delta-like protein 4
14	9606.ENSP00000338207	0.590	Rhombotin-1
15	9606.ENSP00000205143	0.545	Delta-like protein 3
16	9606.ENSP00000257600	0.542	E3 ubiquitin-protein ligase DTX1
17	9606.ENSP00000380334	0.535	Neutrophil cytosol factor 4
18	9606.ENSP00000345206	0.518	Recombining binding protein suppressor of hairless
19	9606.ENSP00000356357	0.511	LIM/homeobox protein Lhx9
20	9606.ENSP00000341243	0.503	Recombining binding protein suppressor of hairless-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0033829	0.941	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity
GO:0005488	0.937	binding
GO:0005515	0.934	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.941	multicellular organismal process
GO:0048856	0.928	anatomical structure development
GO:0007275	0.897	multicellular organism development
GO:0009987	0.888	cellular process
GO:0065007	0.837	biological regulation
GO:0050789	0.771	regulation of biological process
GO:0050794	0.711	regulation of cellular process
GO:0007389	0.504	pattern specification process
GO:0050896	0.459	response to stimulus
GO:0048518	0.395	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.995	extracellular region
GO:0012505	0.983	endomembrane system
GO:0016020	0.961	membrane
GO:0043231	0.959	intracellular membrane-bounded organelle
GO:0005737	0.954	cytoplasm
GO:0031090	0.751	organelle membrane
GO:0005794	0.740	Golgi apparatus
GO:0000139	0.638	Golgi membrane
GO:0005615	0.568	extracellular space
GO:0005783	0.316	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
EC:2.4.1.222	0.941	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase.

[back to server]