StarFunc result for job id O00592

User Input

>input (558 residues)
MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDT
AQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTI
ESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT
PHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVF
HHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTS
PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLN
LTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLP
AKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALY
GCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIV
PLDNLTKDDLDEEEDTHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00592	1.000	1.000	2.003E-76	558	1.000	1.000	O00592.pdb.gz	PODXL_HUMAN Podocalyxin OS=Homo sapiens OX=9606 GN=PODXL PE=1 SV=2
2	AFDB:O57604	0.209	0.205	1.945E-18	571	0.326	0.319	O57604.pdb.gz	PODXL_CHICK Podocalyxin OS=Gallus gallus OX=9031 GN=PODXL PE=1 SV=1
3	AFDB:Q9VA38	0.114	0.066	8.528E-3	1105	0.156	0.079	Q9VA38.pdb.gz	WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster OX=7227 GN=wts PE=1 SV=1
4	AFDB:Q3LHL9	0.083	0.038	1.176E-2	1658	0.174	0.059	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
5	AFDB:Q9GYQ9	0.095	0.069	1.730E-2	796	0.143	0.101	Q9GYQ9.pdb.gz	Q9GYQ9_CAEEL CCR4-NOT transcription complex subunit 4 OS=Caenorhabditis elegans OX=6239 GN=ntl-4 PE=1 SV=2
6	AFDB:Q02496	0.083	0.076	2.545E-2	630	0.208	0.184	Q02496.pdb.gz	MUC1_MOUSE Mucin-1 OS=Mus musculus OX=10090 GN=Muc1 PE=1 SV=2
7	AFDB:Q5AMQ3	0.122	0.070	2.714E-2	1176	0.154	0.073	Q5AMQ3.pdb.gz	Q5AMQ3_CANAL Rga2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RGA2 PE=4 SV=1
8	AFDB:M9PB92	0.080	0.046	5.164E-2	1062	0.159	0.084	M9PB92.pdb.gz	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
9	AFDB:O54826	0.066	0.040	5.507E-2	1068	0.170	0.089	O54826.pdb.gz	AF10_MOUSE Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2
10	AFDB:Q583Y9	0.071	0.048	5.873E-2	933	0.165	0.099	Q583Y9.pdb.gz	Q583Y9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.600 PE=4 SV=1
11	PDB:5ew5A	0.060	0.067	1.188	490	0.011	0.012	5ew5A.pdb.gz
12	PDB:5wrpD	0.055	0.064	1.267	473	0.013	0.015	5wrpD.pdb.gz	Allosteric pyruvate kinase-based "logic gate" synergistically senses energy and sugar levels in Mycobacterium tuberculosis.
13	PDB:7nsuD	0.061	0.078	1.267	420	0.011	0.014	7nsuD.pdb.gz
14	PDB:7p2e8	0.079	0.165	1.537	191	0.016	0.047	7p2e8.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
15	PDB:7tjjI	0.055	0.074	1.537	380	0.011	0.016	7tjjI.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
16	PDB:5wrpC	0.057	0.079	1.639	378	0.014	0.021	5wrpC.pdb.gz	Allosteric pyruvate kinase-based "logic gate" synergistically senses energy and sugar levels in Mycobacterium tuberculosis.
17	PDB:7acj5	0.077	0.205	1.748	150	0.018	0.067	7acj5.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
18	PDB:5eq6A	0.070	0.102	1.988	357	0.018	0.028	5eq6A.pdb.gz	PilN Binding Modulates the Structure and Binding Partners of the Pseudomonas aeruginosa Type IVa Pilus Protein PilM.
19	PDB:2azoB	0.062	0.126	2.120	227	0.030	0.075	2azoB.pdb.gz
20	PDB:1tedA	0.055	0.078	2.571	368	0.016	0.024	1tedA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00592	0.0	1117	558	1.000	1.000	PODXL_HUMAN Podocalyxin OS=Homo sapiens OX=9606 GN=PODXL PE=1 SV=2
2	Q52S86	1.58e-130	394	571	0.333	0.326	PODXL_CANLF Podocalyxin OS=Canis lupus familiaris OX=9615 GN=PODXL PE=1 SV=1
3	Q28645	3.29e-113	349	551	0.312	0.316	PODXL_RABIT Podocalyxin OS=Oryctolagus cuniculus OX=9986 GN=PODXL PE=1 SV=1
4	Q9R0M4	4.01e-112	345	503	0.294	0.326	PODXL_MOUSE Podocalyxin OS=Mus musculus OX=10090 GN=Podxl PE=1 SV=2
5	Q9WTQ2	6.06e-110	338	485	0.297	0.342	PODXL_RAT Podocalyxin OS=Rattus norvegicus OX=10116 GN=Podxl PE=1 SV=2
6	O57604	2.21e-68	233	571	0.233	0.228	PODXL_CHICK Podocalyxin OS=Gallus gallus OX=9031 GN=PODXL PE=1 SV=1
7	Q5RHU2	6.39e-34	135	445	0.124	0.155	Q5RHU2_DANRE Podocalyxin OS=Danio rerio OX=7955 GN=si:dkey-146n1.1 PE=2 SV=1
8	C9J370	3.44e-07	53.9	250	0.048	0.108	C9J370_HUMAN POM121 and ZP3 fusion (Fragment) OS=Homo sapiens OX=9606 GN=POMZP3 PE=4 SV=1
9	F8W8G5	5.35e-07	55.1	726	0.070	0.054	F8W8G5_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
10	Q04864	1.37e-06	53.5	619	0.047	0.042	REL_HUMAN Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1
11	A0A087WTI6	3.74e-06	52.4	660	0.050	0.042	A0A087WTI6_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
12	Q9Y2Z0	1.81e-05	49.7	365	0.048	0.074	SGT1_HUMAN Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3
13	Q9NZ53	2.09e-05	49.7	605	0.115	0.106	PDXL2_HUMAN Podocalyxin-like protein 2 OS=Homo sapiens OX=9606 GN=PODXL2 PE=1 SV=1
14	Q5JRR6	1.38e-04	47.0	506	0.043	0.047	Q5JRR6_HUMAN Ubiquitin like modifier activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=1
15	H0YLU7	1.90e-04	46.2	406	0.061	0.084	H0YLU7_HUMAN Electron transfer flavoprotein subunit alpha OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=2
16	G5E9D4	6.40e-04	45.1	535	0.054	0.056	G5E9D4_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=1
17	I3L0Y6	0.001	42.4	188	0.036	0.106	I3L0Y6_HUMAN NmrA like redox sensor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NMRAL1 PE=1 SV=1
18	Q6UX73	0.001	43.9	402	0.045	0.062	CP089_HUMAN UPF0764 protein C16orf89 OS=Homo sapiens OX=9606 GN=C16orf89 PE=1 SV=2
19	O15488	0.002	43.5	501	0.039	0.044	GLYG2_HUMAN Glycogenin-2 OS=Homo sapiens OX=9606 GN=GYG2 PE=1 SV=2
20	Q9UL10	0.003	42.7	396	0.039	0.056	Q9UL10_HUMAN Sarcosine dehydrogenase OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06365 CD34_antigen	1.3e-64	229.2	CD34/Podocalyxin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367817

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000408005	0.994	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
2	9606.ENSP00000356042	0.992	Ezrin
3	9606.ENSP00000236147	0.988	L-selectin
4	9606.ENSP00000262613	0.974	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
5	9606.ENSP00000377789	0.835	Synaptopodin
6	9606.ENSP00000368190	0.826	Nephrin
7	9606.ENSP00000356587	0.783	Podocin
8	9606.ENSP00000447006	0.763	Contactin-1
9	9606.ENSP00000310036	0.709	Hematopoietic progenitor cell antigen CD34
10	9606.ENSP00000263686	0.708	P-selectin
11	9606.ENSP00000386884	0.704	C-X-C chemokine receptor type 4
12	9606.ENSP00000331327	0.703	Wilms tumor protein
13	9606.ENSP00000373905	0.699	Dynamin-2
14	9606.ENSP00000379839	0.649	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
15	9606.ENSP00000352264	0.644	CD2-associated protein
16	9606.ENSP00000281171	0.630	Receptor-type tyrosine-protein phosphatase O
17	9606.ENSP00000331736	0.617	E-selectin
18	9606.ENSP00000360672	0.612	Partitioning defective 6 homolog beta
19	9606.ENSP00000281537	0.606	Tight junction protein ZO-1
20	9606.ENSP00000215637	0.605	Mucosal addressin cell adhesion molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.958	positive regulation of biological process
GO:0048522	0.951	positive regulation of cellular process
GO:0030155	0.917	regulation of cell adhesion
GO:0009987	0.910	cellular process
GO:0040012	0.888	regulation of locomotion
GO:0030334	0.876	regulation of cell migration
GO:0022407	0.710	regulation of cell-cell adhesion
GO:0032501	0.636	multicellular organismal process
GO:0048519	0.588	negative regulation of biological process
GO:0048523	0.573	negative regulation of cellular process
GO:0032502	0.548	developmental process
GO:0048856	0.522	anatomical structure development
GO:0040017	0.422	positive regulation of locomotion
GO:0030335	0.398	positive regulation of cell migration
GO:0050896	0.325	response to stimulus
GO:0007275	0.321	multicellular organism development
GO:0045785	0.316	positive regulation of cell adhesion
GO:0033628	0.302	regulation of cell adhesion mediated by integrin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.995	organelle
GO:0120025	0.995	plasma membrane bounded cell projection
GO:0043227	0.992	membrane-bounded organelle
GO:0043229	0.987	intracellular organelle
GO:0005576	0.975	extracellular region
GO:0005615	0.968	extracellular space
GO:0031982	0.955	vesicle
GO:0098858	0.948	actin-based cell projection
GO:0005737	0.937	cytoplasm
GO:0043231	0.935	intracellular membrane-bounded organelle
GO:0043228	0.915	non-membrane-bounded organelle
GO:0015630	0.872	microtubule cytoskeleton
GO:0005815	0.791	microtubule organizing center
GO:0098590	0.782	plasma membrane region
GO:0005813	0.774	centrosome
GO:0030175	0.753	filopodium
GO:0031252	0.751	cell leading edge
GO:0030027	0.726	lamellipodium
GO:0034451	0.726	centriolar satellite
GO:0031981	0.726	nuclear lumen
GO:0005730	0.714	nucleolus
GO:0001726	0.710	ruffle
GO:1903561	0.680	extracellular vesicle
GO:0070062	0.673	extracellular exosome
GO:0012505	0.389	endomembrane system
GO:0031410	0.345	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]