StarFunc result for job id O00602

User Input

>input (326 residues)
MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAP
GPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD
LLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFG
SQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFV
GGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESY
ANGINWSAAKGYKYSYKVSEMKVRPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00602	1.000	1.000	5.192E-62	326	1.000	1.000	O00602.pdb.gz	FCN1_HUMAN Ficolin-1 OS=Homo sapiens OX=9606 GN=FCN1 PE=1 SV=2
2	AFDB:O70497	0.745	0.773	3.424E-51	314	0.718	0.745	O70497.pdb.gz	FCN2_MOUSE Ficolin-2 OS=Mus musculus OX=10090 GN=Fcn2 PE=2 SV=2
3	AFDB:Q15485	0.668	0.695	1.089E-49	313	0.767	0.799	Q15485.pdb.gz	FCN2_HUMAN Ficolin-2 OS=Homo sapiens OX=9606 GN=FCN2 PE=1 SV=2
4	AFDB:O75636	0.638	0.694	4.878E-35	299	0.439	0.478	O75636.pdb.gz	FCN3_HUMAN Ficolin-3 OS=Homo sapiens OX=9606 GN=FCN3 PE=1 SV=2
5	AFDB:Q8N539	0.642	0.456	2.763E-33	461	0.359	0.254	Q8N539.pdb.gz	FBCD1_HUMAN Fibrinogen C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FIBCD1 PE=1 SV=2
6	AFDB:Q9D1H9	0.641	0.809	8.298E-32	257	0.347	0.440	Q9D1H9.pdb.gz	MFAP4_MOUSE Microfibril-associated glycoprotein 4 OS=Mus musculus OX=10090 GN=Mfap4 PE=1 SV=1
7	AFDB:Q9U8W8	0.647	0.722	1.763E-30	292	0.328	0.366	Q9U8W8.pdb.gz	TL5A_TACTR Techylectin-5A OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
8	AFDB:B0UXH5	0.650	0.415	4.979E-30	519	0.331	0.208	B0UXH5.pdb.gz	B0UXH5_DANRE Angiopoietin-like 2b OS=Danio rerio OX=7955 GN=angptl2 PE=4 SV=1
9	AFDB:Q9U8W7	0.629	0.649	7.037E-30	316	0.340	0.351	Q9U8W7.pdb.gz	TL5B_TACTR Techylectin-5B OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
10	PDB:1jc9A	0.637	0.940	1.363E-29	220	0.319	0.473	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
11	AFDB:Q5KQU0	0.650	0.446	1.578E-29	480	0.319	0.217	Q5KQU0.pdb.gz	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
12	PDB:1m1jB	0.616	0.501	1.245E-23	402	0.282	0.229	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
13	PDB:3ghgI	0.621	0.516	2.791E-23	394	0.304	0.251	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
14	PDB:3ghgB	0.604	0.493	3.515E-23	401	0.285	0.232	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
15	PDB:1ei3C	0.619	0.511	3.944E-23	397	0.294	0.242	1ei3C.pdb.gz
16	PDB:4wmqA	0.236	0.267	2.527E-5	283	0.074	0.085	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
17	PDB:5zc0A	0.232	0.264	1.346E-4	281	0.067	0.078	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
18	PDB:7fdeP	0.179	0.278	2.040E-1	181	0.046	0.083	7fdeP.pdb.gz
19	PDB:2wzpP	0.100	0.106	5.132E-1	298	0.095	0.104	2wzpP.pdb.gz
20	PDB:4qvbB	0.108	0.213	8.140E-1	144	0.018	0.042	4qvbB.pdb.gz	Molecular insights into the binding of coenzyme F420 to the conserved protein Rv1155 from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00602	0.0	674	326	1.000	1.000	FCN1_HUMAN Ficolin-1 OS=Homo sapiens OX=9606 GN=FCN1 PE=1 SV=2
2	O70497	3.94e-177	494	314	0.718	0.745	FCN2_MOUSE Ficolin-2 OS=Mus musculus OX=10090 GN=Fcn2 PE=2 SV=2
3	Q15485	6.53e-166	466	313	0.745	0.776	FCN2_HUMAN Ficolin-2 OS=Homo sapiens OX=9606 GN=FCN2 PE=1 SV=2
4	O75636	2.40e-82	253	299	0.426	0.465	FCN3_HUMAN Ficolin-3 OS=Homo sapiens OX=9606 GN=FCN3 PE=1 SV=2
5	P55918	1.18e-68	216	255	0.365	0.467	MFAP4_BOVIN Microfibril-associated glycoprotein 4 OS=Bos taurus OX=9913 GN=MFAP4 PE=1 SV=2
6	Q8N539	1.38e-68	223	461	0.356	0.252	FBCD1_HUMAN Fibrinogen C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FIBCD1 PE=1 SV=2
7	Q9U8W7	4.55e-67	214	316	0.340	0.351	TL5B_TACTR Techylectin-5B OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
8	Q9D1H9	1.76e-66	211	257	0.344	0.436	MFAP4_MOUSE Microfibril-associated glycoprotein 4 OS=Mus musculus OX=10090 GN=Mfap4 PE=1 SV=1
9	P55083	1.23e-65	209	255	0.344	0.439	MFAP4_HUMAN Microfibril-associated glycoprotein 4 OS=Homo sapiens OX=9606 GN=MFAP4 PE=1 SV=2
10	Q92752	2.17e-60	211	1358	0.322	0.077	TENR_HUMAN Tenascin-R OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=3
11	A1L306	3.04e-60	210	1257	0.322	0.084	A1L306_HUMAN TNR protein OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=1
12	O43827	6.80e-60	197	346	0.362	0.341	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
13	Q9U8W8	1.50e-59	194	292	0.331	0.370	TL5A_TACTR Techylectin-5A OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
14	Q7T3T6	1.89e-59	208	1350	0.316	0.076	Q7T3T6_DANRE Tenascin-R OS=Danio rerio OX=7955 GN=tnr PE=1 SV=1
15	Q8BYI9	6.65e-59	206	1358	0.325	0.078	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
16	Q05546	5.00e-58	204	1356	0.325	0.078	TENR_RAT Tenascin-R OS=Rattus norvegicus OX=10116 GN=Tnr PE=1 SV=1
17	H1A489	5.66e-58	204	1356	0.313	0.075	H1A489_TAEGU Tenascin R OS=Taeniopygia guttata OX=59729 GN=TNR PE=3 SV=2
18	A5A8W4	1.45e-55	197	4137	0.331	0.026	A5A8W4_PIG Tenascin XB OS=Sus scrofa OX=9823 GN=TNXB PE=3 SV=1
19	Q08830	1.85e-55	184	312	0.313	0.327	FGL1_HUMAN Fibrinogen-like protein 1 OS=Homo sapiens OX=9606 GN=FGL1 PE=1 SV=3
20	F1QG23	4.75e-55	184	335	0.322	0.313	F1QG23_DANRE Fibrinogen-like protein 1 isoform X2 OS=Danio rerio OX=7955 GN=si:ch211-287a12.9 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	4.6e-07	40.8	Collagen triple helix repeat (20 copies)
2	PF00147 Fibrinogen_C	5.7e-72	253.6	Fibrinogen beta and gamma chains, C-terminal globular domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360871

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295927	0.997	Pentraxin-related protein PTX3
2	9606.ENSP00000255030	0.986	C-reactive protein
3	9606.ENSP00000296280	0.973	Mannan binding lectin serine peptidase 1
4	9606.ENSP00000383690	0.954	Mannan-binding lectin serine protease 2
5	9606.ENSP00000396688	0.951	Complement C4-A
6	9606.ENSP00000415941	0.951	Complement C4-B
7	9606.ENSP00000299367	0.918	Complement C2
8	9606.ENSP00000385035	0.874	Complement C1s subcomponent
9	9606.ENSP00000351807	0.836	Elastin
10	9606.ENSP00000473159	0.784	Free fatty acid receptor 2
11	9606.ENSP00000438615	0.783	Complement C1r subcomponent
12	9606.ENSP00000375629	0.771	Leukocyte immunoglobulin-like receptor subfamily B member 2
13	9606.ENSP00000291744	0.720	Ficolin-2
14	9606.ENSP00000262629	0.708	TYRO protein tyrosine kinase-binding protein
15	9606.ENSP00000363079	0.707	Mannose-binding protein C
16	9606.ENSP00000347916	0.703	C-type lectin domain family 12 member A
17	9606.ENSP00000411770	0.701	Collectin-11
18	9606.ENSP00000332723	0.696	Collectin-10
19	9606.ENSP00000357123	0.694	Myeloid cell nuclear differentiation antigen
20	9606.ENSP00000292432	0.673	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097367	1.000	carbohydrate derivative binding
GO:0005515	1.000	protein binding
GO:0031406	0.996	carboxylic acid binding
GO:0033691	0.994	sialic acid binding
GO:0005102	0.985	signaling receptor binding
GO:0042802	0.962	identical protein binding
GO:0030246	0.898	carbohydrate binding
GO:0038023	0.896	signaling receptor activity
GO:0038187	0.749	pattern recognition receptor activity
GO:0001664	0.341	G protein-coupled receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0002376	0.992	immune system process
GO:0048584	0.987	positive regulation of response to stimulus
GO:0050776	0.985	regulation of immune response
GO:0002253	0.983	activation of immune response
GO:0009987	0.981	cellular process
GO:0006955	0.981	immune response
GO:0009605	0.978	response to external stimulus
GO:0006950	0.976	response to stress
GO:0006952	0.968	defense response
GO:0044419	0.965	biological process involved in interspecies interaction between organisms
GO:0009607	0.965	response to biotic stimulus
GO:0051707	0.960	response to other organism
GO:0016192	0.956	vesicle-mediated transport
GO:0006956	0.955	complement activation
GO:0006909	0.954	phagocytosis
GO:0051049	0.952	regulation of transport
GO:0008152	0.942	metabolic process
GO:0060627	0.930	regulation of vesicle-mediated transport
GO:0050766	0.921	positive regulation of phagocytosis
GO:0071704	0.909	organic substance metabolic process
GO:0002699	0.909	positive regulation of immune effector process
GO:0044238	0.901	primary metabolic process
GO:0098542	0.901	defense response to other organism
GO:0006807	0.884	nitrogen compound metabolic process
GO:0043170	0.838	macromolecule metabolic process
GO:0002764	0.831	immune response-regulating signaling pathway
GO:0031347	0.811	regulation of defense response
GO:1901564	0.782	organonitrogen compound metabolic process
GO:0045087	0.781	innate immune response
GO:0002757	0.770	immune response-activating signaling pathway
GO:0032103	0.767	positive regulation of response to external stimulus
GO:0002833	0.765	positive regulation of response to biotic stimulus
GO:0045088	0.759	regulation of innate immune response
GO:0031349	0.756	positive regulation of defense response
GO:0019538	0.753	protein metabolic process
GO:0002758	0.743	innate immune response-activating signaling pathway
GO:0043277	0.709	apoptotic cell clearance
GO:0006508	0.692	proteolysis
GO:0007166	0.667	cell surface receptor signaling pathway
GO:0002768	0.654	immune response-regulating cell surface receptor signaling pathway
GO:0002429	0.604	immune response-activating cell surface receptor signaling pathway
GO:0048519	0.586	negative regulation of biological process
GO:0019222	0.529	regulation of metabolic process
GO:0051239	0.513	regulation of multicellular organismal process
GO:0043903	0.511	regulation of biological process involved in symbiotic interaction
GO:0002221	0.510	pattern recognition receptor signaling pathway
GO:0050792	0.508	regulation of viral process
GO:1903900	0.498	regulation of viral life cycle
GO:0060255	0.497	regulation of macromolecule metabolic process
GO:0048522	0.459	positive regulation of cellular process
GO:0008037	0.455	cell recognition
GO:0052372	0.453	modulation by symbiont of entry into host
GO:0046596	0.430	regulation of viral entry into host cell
GO:0010468	0.389	regulation of gene expression
GO:0009893	0.350	positive regulation of metabolic process
GO:0006897	0.345	endocytosis
GO:0002220	0.345	innate immune response activating cell surface receptor signaling pathway
GO:0051240	0.317	positive regulation of multicellular organismal process
GO:0001817	0.302	regulation of cytokine production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0032991	0.997	protein-containing complex
GO:0043227	0.996	membrane-bounded organelle
GO:0031982	0.994	vesicle
GO:0012505	0.980	endomembrane system
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0071944	0.949	cell periphery
GO:0005737	0.948	cytoplasm
GO:0016020	0.938	membrane
GO:0005886	0.927	plasma membrane
GO:1902494	0.919	catalytic complex
GO:0005615	0.915	extracellular space
GO:0030141	0.902	secretory granule
GO:0070013	0.895	intracellular organelle lumen
GO:0070062	0.886	extracellular exosome
GO:1905286	0.855	serine-type peptidase complex
GO:1905370	0.820	serine-type endopeptidase complex
GO:0031012	0.627	extracellular matrix
GO:0062023	0.615	collagen-containing extracellular matrix
GO:0072562	0.376	blood microparticle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]