StarFunc result for job id O00635

User Input

>input (465 residues)
MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCP
QCRAPFHMDSLRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQ
HKGHTTALVEDVCQGYKEKLQKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIR
SDFKNLQCFLHEEEKSYLWRLEKEEQQTLSRLRDYEAGLGLKSNELKSHILELEEKCQGS
AQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDT
AHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFEVDVGEGTGWD
LGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEA
GVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00635	1.000	1.000	4.315E-88	465	1.000	1.000	O00635.pdb.gz	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
2	AFDB:Q5SZ99	0.585	0.579	3.073E-57	471	0.566	0.558	Q5SZ99.pdb.gz	TRI38_MOUSE E3 ubiquitin-protein ligase TRIM38 OS=Mus musculus OX=10090 GN=Trim38 PE=1 SV=1
3	AFDB:Q5NCC9	0.407	0.393	1.705E-49	485	0.383	0.367	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
4	AFDB:Q62191	0.382	0.378	1.493E-47	470	0.409	0.404	Q62191.pdb.gz	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
5	AFDB:P19474	0.384	0.376	4.191E-47	475	0.424	0.415	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
6	AFDB:A0A024RCP5	0.404	0.366	9.725E-45	518	0.409	0.367	A0A024RCP5.pdb.gz	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
7	AFDB:Q8BGE7	0.395	0.379	3.061E-44	488	0.372	0.355	Q8BGE7.pdb.gz	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
8	AFDB:A0A024RCR1	0.401	0.384	6.451E-44	488	0.400	0.381	A0A024RCR1.pdb.gz
9	AFDB:Q9C030	0.378	0.363	3.816E-43	488	0.372	0.355	Q9C030.pdb.gz	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
10	AFDB:Q96F44	0.380	0.378	2.531E-42	468	0.406	0.404	Q96F44.pdb.gz	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
11	PDB:7y4sA	0.366	0.490	3.352E-20	343	0.181	0.245	7y4sA.pdb.gz
12	PDB:4b3nA	0.334	0.280	4.559E-16	557	0.125	0.104	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:4tn3B	0.371	0.466	6.767E-9	362	0.129	0.166	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:7ccbA	0.260	0.681	2.838E-8	164	0.056	0.159	7ccbA.pdb.gz
15	PDB:7z36B	0.268	0.277	4.489E-8	446	0.101	0.105	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
16	PDB:6swy1	0.254	0.221	2.655E-7	542	0.075	0.065	6swy1.pdb.gz
17	PDB:7nscA	0.269	0.432	5.235E-6	276	0.043	0.072	7nscA.pdb.gz
18	PDB:7nsba	0.258	0.214	9.289E-6	568	0.062	0.051	7nsba.pdb.gz
19	PDB:7tzcA	0.240	0.027	1.093E-4	4404	0.043	0.005	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
20	PDB:5t15B	0.219	0.026	3.644E-4	4170	0.041	0.005	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00635	0.0	971	465	1.000	1.000	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
2	Q5SZ99	1.01e-180	515	471	0.566	0.558	TRI38_MOUSE E3 ubiquitin-protein ligase TRIM38 OS=Mus musculus OX=10090 GN=Trim38 PE=1 SV=1
3	P19474	7.96e-116	350	475	0.417	0.408	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
4	Q3U7K7	2.27e-113	343	462	0.411	0.413	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
5	Q62191	4.59e-113	343	470	0.411	0.406	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
6	Q5NCC9	6.44e-112	340	485	0.385	0.369	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
7	A0A024RCP5	2.58e-99	309	518	0.404	0.363	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
8	Q9HCM9	2.58e-99	309	518	0.404	0.363	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
9	Q96F44	2.97e-96	300	468	0.406	0.404	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
10	Q6AZZ1	9.56e-96	299	485	0.353	0.338	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
11	Q9C030	1.11e-92	291	488	0.387	0.369	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
12	Q8BGE7	3.24e-92	290	488	0.378	0.361	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
13	A0A1U9X8R9	2.72e-89	283	513	0.357	0.324	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
14	P14373	2.72e-89	283	513	0.357	0.324	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
15	Q99PQ2	3.76e-89	281	467	0.385	0.383	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
16	Q62158	5.22e-88	280	513	0.353	0.320	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
17	Q5D7I0	2.51e-79	256	494	0.363	0.342	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
18	Q9C035	1.80e-77	251	493	0.344	0.325	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
19	Q8IYM9	3.46e-76	248	498	0.361	0.337	TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens OX=9606 GN=TRIM22 PE=1 SV=1
20	Q9UDY6	1.42e-72	238	481	0.331	0.320	TRI10_HUMAN Tripartite motif-containing protein 10 OS=Homo sapiens OX=9606 GN=TRIM10 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13765 PRY	4.3e-16	69.6	SPRY-associated domain
2	PF00622 SPRY	6.4e-15	66.7	SPRY domain
3	PF03966 Trm112p	97	15.0	Trm112p-like protein
4	PF04564 U-box	17	17.0	U-box domain
5	PF00643 zf-B_box	2.9e-05	35.4	B-box zinc finger
6	PF00097 zf-C3HC4	0.012	26.7	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	35	15.7	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.16	23.1	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	1.5e-06	39.5	zinc finger of C3HC4-type, RING
10	PF13639 zf-RING_2	0.3	22.8	Ring finger domain
11	PF14634 zf-RING_5	13	17.2	zinc-RING finger domain
12	PF14835 zf-RING_6	41	15.5	zf-RING of BARD1-type protein
13	PF13445 zf-RING_UBOX	0.0011	30.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305161	0.715	E3 ubiquitin-protein ligase TRIM56
2	9606.ENSP00000356426	0.685	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
3	9606.ENSP00000295756	0.661	T-cell receptor-associated transmembrane adapter 1
4	9606.ENSP00000378199	0.646	Heat shock-related 70 kDa protein 2
5	9606.ENSP00000263182	0.633	Gamma-butyrobetaine dioxygenase
6	9606.ENSP00000408295	0.591	Replication factor C subunit 5
7	9606.ENSP00000433623	0.576	TNF receptor-associated factor 6
8	9606.ENSP00000408292	0.568	E3 ubiquitin-protein ligase TRIM32
9	9606.ENSP00000369213	0.513	Probable ATP-dependent RNA helicase DDX58
10	9606.ENSP00000302120	0.500	Probable E3 ubiquitin-protein ligase TRIM8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	0.999	transcription coactivator activity
GO:0019787	0.979	ubiquitin-like protein transferase activity
GO:0004842	0.973	ubiquitin-protein transferase activity
GO:0061630	0.847	ubiquitin protein ligase activity
GO:0042802	0.560	identical protein binding
GO:0019899	0.365	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0048583	0.989	regulation of response to stimulus
GO:0048518	0.983	positive regulation of biological process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0010646	0.975	regulation of cell communication
GO:0023051	0.974	regulation of signaling
GO:0050792	0.955	regulation of viral process
GO:0009966	0.955	regulation of signal transduction
GO:0010468	0.954	regulation of gene expression
GO:0043122	0.948	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048584	0.947	positive regulation of response to stimulus
GO:0080090	0.946	regulation of primary metabolic process
GO:0051171	0.946	regulation of nitrogen compound metabolic process
GO:1903900	0.945	regulation of viral life cycle
GO:0031323	0.941	regulation of cellular metabolic process
GO:0048522	0.939	positive regulation of cellular process
GO:0051090	0.924	regulation of DNA-binding transcription factor activity
GO:0043903	0.923	regulation of biological process involved in symbiotic interaction
GO:0051091	0.907	positive regulation of DNA-binding transcription factor activity
GO:0009987	0.875	cellular process
GO:0052372	0.859	modulation by symbiont of entry into host
GO:0050896	0.848	response to stimulus
GO:0009967	0.842	positive regulation of signal transduction
GO:0043123	0.809	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0008152	0.755	metabolic process
GO:0048519	0.731	negative regulation of biological process
GO:0071704	0.725	organic substance metabolic process
GO:0044238	0.721	primary metabolic process
GO:0051092	0.706	positive regulation of NF-kappaB transcription factor activity
GO:0006807	0.698	nitrogen compound metabolic process
GO:1901564	0.631	organonitrogen compound metabolic process
GO:0043170	0.616	macromolecule metabolic process
GO:0019538	0.576	protein metabolic process
GO:0046596	0.566	regulation of viral entry into host cell
GO:0006950	0.563	response to stress
GO:0048524	0.526	positive regulation of viral process
GO:0070647	0.526	protein modification by small protein conjugation or removal
GO:0032446	0.521	protein modification by small protein conjugation
GO:0009893	0.490	positive regulation of metabolic process
GO:0009615	0.482	response to virus
GO:0001817	0.444	regulation of cytokine production
GO:0016567	0.438	protein ubiquitination
GO:0010604	0.417	positive regulation of macromolecule metabolic process
GO:0002831	0.411	regulation of response to biotic stimulus
GO:0048523	0.404	negative regulation of cellular process
GO:0031347	0.392	regulation of defense response
GO:0050776	0.388	regulation of immune response
GO:0006952	0.387	defense response
GO:0044237	0.379	cellular metabolic process
GO:0032101	0.361	regulation of response to external stimulus
GO:0002376	0.350	immune system process
GO:0051607	0.338	defense response to virus
GO:0031325	0.301	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043229	0.868	intracellular organelle
GO:0043231	0.860	intracellular membrane-bounded organelle
GO:0005634	0.639	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.979	Transferases.

[back to server]