StarFunc result for job id O00712

User Input

>input (420 residues)
MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDE
LLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDC
LRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFL
AYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFP
IGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGS
RTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTP
PPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQSWYLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97863	0.574	0.431	5.061E-55	570	0.983	0.725	P97863.pdb.gz	NFIB_MOUSE Nuclear factor 1 B-type OS=Mus musculus OX=10090 GN=Nfib PE=1 SV=2
2	AFDB:Q5VW27	0.538	0.466	7.411E-55	487	0.990	0.854	Q5VW27.pdb.gz	Q5VW27_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
3	AFDB:A0A286YEX4	0.501	0.405	7.154E-37	530	0.640	0.508	A0A286YEX4.pdb.gz	A0A286YEX4_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=1
4	AFDB:Q14938	0.511	0.432	2.372E-36	502	0.607	0.508	Q14938.pdb.gz	NFIX_HUMAN Nuclear factor 1 X-type OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=2
5	AFDB:B1AKN7	0.540	0.488	2.505E-36	466	0.607	0.547	B1AKN7.pdb.gz	B1AKN7_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
6	AFDB:B1AKN8	0.524	0.418	3.474E-36	532	0.626	0.494	B1AKN8.pdb.gz	B1AKN8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
7	AFDB:B1AKN5	0.491	0.426	1.284E-35	487	0.621	0.536	B1AKN5.pdb.gz	B1AKN5_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
8	AFDB:A0A0R4IU09	0.497	0.485	1.881E-35	432	0.557	0.542	A0A0R4IU09.pdb.gz
9	AFDB:C9JWJ8	0.503	0.523	3.766E-34	403	0.550	0.573	C9JWJ8.pdb.gz	C9JWJ8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=3
10	AFDB:A0A1B0GVN4	0.247	0.244	5.515E-34	424	0.795	0.788	A0A1B0GVN4.pdb.gz	A0A1B0GVN4_HUMAN Nuclear factor I B OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
11	PDB:3j79V	0.054	0.117	2.300	155	0.024	0.065	3j79V.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
12	PDB:7pubIA	0.088	0.059	5.208	693	0.036	0.022	7pubIA.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
13	PDB:7wg5AG	0.071	0.208	5.208	99	0.040	0.172	7wg5AG.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
14	PDB:4v6wCT	0.047	0.103	5.808	158	0.024	0.063	4v6wCT.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:4y86B	0.068	0.077	6.133	326	0.038	0.049	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
16	PDB:7ajtCI	0.098	0.159	8.054	182	0.060	0.137	7ajtCI.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:3zecB	0.071	0.077	8.505	371	0.038	0.043	3zecB.pdb.gz	Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
18	PDB:2jr7A	0.056	0.188	9.484	84	0.029	0.143	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein
19	PDB:6y9bC	0.082	0.127	9.484	244	0.026	0.045	6y9bC.pdb.gz	Cryo-electron microscopy structure and potential enzymatic function of human six-transmembrane epithelial antigen of the prostate 1 (STEAP1).
20	PDB:7evoC	0.081	0.081	9.484	422	0.050	0.050	7evoC.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRX8	840	446	0.981	0.924	A0A0A0MRX8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
2	A0A1B0GU97	830	478	0.964	0.847	A0A1B0GU97_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
3	A0A1B0GVN4	545	424	0.731	0.724	A0A1B0GVN4_HUMAN Nuclear factor I B OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
4	A0A1B0GW37	843	411	0.976	0.998	A0A1B0GW37_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
5	A0A1B0GWI9	831	480	0.964	0.844	A0A1B0GWI9_HUMAN Nuclear factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
6	A0A1B0GWJ4	852	445	0.988	0.933	A0A1B0GWJ4_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
7	A0A2R8Y7V8	834	566	0.971	0.721	A0A2R8Y7V8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
8	A0A8I6AFY4	853	570	0.983	0.725	A0A8I6AFY4_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
9	A0A8J8YK50	852	503	0.983	0.821	A0A8J8YK50_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
10	F7END1	848	486	0.981	0.848	F7END1_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
11	F7F711	850	491	0.981	0.839	F7F711_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
12	O00712	865	420	1.000	1.000	NFIB_HUMAN Nuclear factor 1 B-type OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=2
13	O70185	852	561	0.983	0.736	O70185_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=2
14	O70186	851	494	0.983	0.836	O70186_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=2
15	O70187	862	420	0.995	0.995	O70187_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=3 SV=2
16	P97863	851	570	0.981	0.723	NFIB_MOUSE Nuclear factor 1 B-type OS=Mus musculus OX=10090 GN=Nfib PE=1 SV=2
17	Q5VW26	856	570	0.988	0.728	Q5VW26_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
18	Q5VW27	853	487	0.988	0.852	Q5VW27_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
19	Q5VW28	865	420	1.000	1.000	Q5VW28_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=2 SV=1
20	Q5VW30	854	561	0.988	0.740	Q5VW30_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00859 CTF_NFI	1.9e-81	285.6	CTF/NF-I family transcription modulation region
2	PF03165 MH1	1e-08	46.7	MH1 domain
3	PF10524 NfI_DNAbd_pre-N	1.7e-22	90.3	Nuclear factor I protein pre-N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000019213

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000017209	0.768	Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
2	9555.ENSPANP00000019967	0.724	Neurofibromin 1
3	9555.ENSPANP00000001958	0.710	Amyloid beta (A4) precursor protein
4	9555.ENSPANP00000008252	0.641	Nicastrin
5	9555.ENSPANP00000002208	0.612	Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
6	9555.ENSPANP00000009520	0.612	Gem (nuclear organelle) associated protein 8
7	9555.ENSPANP00000009105	0.563	Recognizes and binds the palindromic sequence 5'- TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
8	9555.ENSPANP00000013305	0.561	Polymerase (RNA) II (DNA directed) polypeptide F
9	9555.ENSPANP00000008976	0.560	Leucine rich repeat containing 8 family, member D
10	9555.ENSPANP00000004037	0.525	HNF1 homeobox A
11	9555.ENSPANP00000005108	0.525	Fibronectin leucine rich transmembrane protein 3
12	9555.ENSPANP00000003625	0.511	During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS
13	9555.ENSPANP00000008050	0.503	Zinc finger protein 274
14	9555.ENSPANP00000020322	0.502	Ecdysoneless cell cycle regulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	0.995	sequence-specific double-stranded DNA binding
GO:0000976	0.970	transcription cis-regulatory region binding
GO:0005515	0.961	protein binding
GO:0003700	0.950	DNA-binding transcription factor activity
GO:0000987	0.948	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.932	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.879	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.576	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.409	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080090	0.994	regulation of primary metabolic process
GO:0051172	0.986	negative regulation of nitrogen compound metabolic process
GO:0010605	0.986	negative regulation of macromolecule metabolic process
GO:0031324	0.986	negative regulation of cellular metabolic process
GO:0045892	0.982	negative regulation of DNA-templated transcription
GO:0048522	0.976	positive regulation of cellular process
GO:0051173	0.958	positive regulation of nitrogen compound metabolic process
GO:0031325	0.958	positive regulation of cellular metabolic process
GO:0010604	0.954	positive regulation of macromolecule metabolic process
GO:0031328	0.951	positive regulation of cellular biosynthetic process
GO:0010557	0.860	positive regulation of macromolecule biosynthetic process
GO:1903508	0.809	positive regulation of nucleic acid-templated transcription
GO:0045893	0.799	positive regulation of DNA-templated transcription
GO:0009987	0.510	cellular process
GO:0048856	0.465	anatomical structure development
GO:0007275	0.337	multicellular organism development
GO:0048731	0.330	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005730	0.986	nucleolus
GO:0001650	0.982	fibrillar center
GO:0005654	0.969	nucleoplasm
GO:0005737	0.515	cytoplasm
GO:0012505	0.472	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]