StarFunc result for job id O00744

User Input

>input (389 residues)
MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00744	1.000	1.000	7.387E-71	389	1.000	1.000	O00744.pdb.gz	WN10B_HUMAN Protein Wnt-10b OS=Homo sapiens OX=9606 GN=WNT10B PE=1 SV=2
2	AFDB:Q801F7	0.771	0.705	8.018E-47	427	0.648	0.590	Q801F7.pdb.gz	WN10B_DANRE Protein Wnt-10b OS=Danio rerio OX=7955 GN=wnt10b PE=2 SV=1
3	AFDB:P43446	0.804	0.710	8.897E-47	442	0.573	0.505	P43446.pdb.gz	WN10A_DANRE Protein Wnt-10a OS=Danio rerio OX=7955 GN=wnt10a PE=1 SV=1
4	AFDB:P70701	0.784	0.734	3.818E-46	417	0.617	0.576	P70701.pdb.gz	WN10A_MOUSE Protein Wnt-10a OS=Mus musculus OX=10090 GN=Wnt10a PE=2 SV=1
5	AFDB:Q3C2H6	0.739	0.812	6.352E-34	353	0.355	0.391	Q3C2H6.pdb.gz	Q3C2H6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt6 PE=2 SV=1
6	AFDB:Q3L254	0.711	0.787	2.183E-32	349	0.344	0.384	Q3L254.pdb.gz	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
7	AFDB:Q9Y6F9	0.719	0.764	2.688E-32	365	0.401	0.427	Q9Y6F9.pdb.gz	WNT6_HUMAN Protein Wnt-6 OS=Homo sapiens OX=9606 GN=WNT6 PE=1 SV=2
8	AFDB:A0A0G2K3B7	0.714	0.780	3.868E-32	353	0.383	0.422	A0A0G2K3B7.pdb.gz	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
9	AFDB:F1QK98	0.732	0.777	5.864E-32	365	0.365	0.389	F1QK98.pdb.gz
10	AFDB:A0A1D5PX88	0.726	0.751	6.507E-32	376	0.365	0.378	A0A1D5PX88.pdb.gz
11	PDB:6ahyB	0.683	0.839	6.102E-27	313	0.347	0.431	6ahyB.pdb.gz
12	PDB:4f0aB	0.624	0.812	2.011E-22	294	0.262	0.347	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:7c7sA	0.124	0.086	3.978	685	0.059	0.034	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
14	PDB:8a1dA	0.046	0.035	5.435	533	0.023	0.017	8a1dA.pdb.gz	Cryo-EM structures of perforin-2 in isolation and assembled on a membrane suggest a mechanism for pore formation.
15	PDB:6sb3A	0.068	0.046	6.353	604	0.010	0.007	6sb3A.pdb.gz
16	PDB:7nnlB	0.074	0.047	6.353	682	0.072	0.041	7nnlB.pdb.gz	Deciphering ion transport and ATPase coupling in the intersubunit tunnel of KdpFABC.
17	PDB:5xvrA	0.051	0.052	7.049	381	0.018	0.018	5xvrA.pdb.gz	Structural basis of protein arginine rhamnosylation by glycosyltransferase EarP
18	PDB:6fecX	0.068	0.115	7.425	190	0.057	0.116	6fecX.pdb.gz	Structure of a human cap-dependent 48S translation pre-initiation complex.
19	PDB:3j6bO	0.039	0.058	7.822	223	0.013	0.022	3j6bO.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
20	PDB:4v4kY	0.079	0.174	7.822	146	0.028	0.075	4v4kY.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00744	0.0	792	389	1.000	1.000	WN10B_HUMAN Protein Wnt-10b OS=Homo sapiens OX=9606 GN=WNT10B PE=1 SV=2
2	P48614	0.0	767	389	0.969	0.969	WN10B_MOUSE Protein Wnt-10b OS=Mus musculus OX=10090 GN=Wnt10b PE=2 SV=1
3	Q801F7	1.13e-178	505	427	0.648	0.590	WN10B_DANRE Protein Wnt-10b OS=Danio rerio OX=7955 GN=wnt10b PE=2 SV=1
4	P43446	1.11e-167	478	442	0.596	0.525	WN10A_DANRE Protein Wnt-10a OS=Danio rerio OX=7955 GN=wnt10a PE=1 SV=1
5	P70701	1.26e-166	474	417	0.607	0.566	WN10A_MOUSE Protein Wnt-10a OS=Mus musculus OX=10090 GN=Wnt10a PE=2 SV=1
6	Q9GZT5	5.04e-166	473	417	0.620	0.578	WN10A_HUMAN Protein Wnt-10a OS=Homo sapiens OX=9606 GN=WNT10A PE=1 SV=1
7	Q9DEB8	3.79e-86	267	349	0.355	0.395	Q9DEB8_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT7A PE=2 SV=1
8	A0A0G2K3B7	4.24e-86	267	353	0.368	0.405	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
9	Q3L254	7.98e-86	266	349	0.362	0.404	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
10	P28047	1.67e-85	265	349	0.373	0.415	WNT7B_MOUSE Protein Wnt-7b OS=Mus musculus OX=10090 GN=Wnt7b PE=1 SV=1
11	Q5NSW6	1.67e-85	265	349	0.373	0.415	Q5NSW6_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=2 SV=1
12	P24383	2.48e-85	265	349	0.362	0.404	WNT7A_MOUSE Protein Wnt-7a OS=Mus musculus OX=10090 GN=Wnt7a PE=1 SV=2
13	O00755	5.96e-85	264	349	0.342	0.381	WNT7A_HUMAN Protein Wnt-7a OS=Homo sapiens OX=9606 GN=WNT7A PE=1 SV=2
14	M0R9D3	6.16e-85	264	349	0.342	0.381	M0R9D3_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7a PE=3 SV=1
15	P56706	1.46e-84	263	349	0.368	0.410	WNT7B_HUMAN Protein Wnt-7b OS=Homo sapiens OX=9606 GN=WNT7B PE=1 SV=2
16	P22724	5.10e-84	261	351	0.380	0.422	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
17	P56705	6.34e-84	261	351	0.378	0.419	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
18	Q9QXQ5	2.47e-83	259	351	0.380	0.422	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
19	P56704	3.26e-82	257	352	0.378	0.418	WNT3A_HUMAN Protein Wnt-3a OS=Homo sapiens OX=9606 GN=WNT3A PE=1 SV=2
20	Q2LMP1	4.22e-82	256	352	0.380	0.420	WNT3A_CHICK Protein Wnt-3a OS=Gallus gallus OX=9031 GN=WNT3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	1e-111	385.0	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301061

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427514	0.954	CCAAT/enhancer-binding protein alpha
2	9606.ENSP00000322304	0.949	Protein-serine O-palmitoleoyltransferase porcupine
3	9606.ENSP00000261349	0.948	Low-density lipoprotein receptor-related protein 6
4	9606.ENSP00000294304	0.939	Low-density lipoprotein receptor-related protein 5
5	9606.ENSP00000293549	0.917	Proto-oncogene Wnt-1
6	9606.ENSP00000233948	0.914	Protein Wnt-6
7	9606.ENSP00000272164	0.913	Protein Wnt-9a
8	9606.ENSP00000222462	0.912	Protein Wnt-16
9	9606.ENSP00000340677	0.912	Protein Wnt-8b
10	9606.ENSP00000426653	0.912	Protein Wnt-8a
11	9606.ENSP00000265441	0.911	Protein Wnt-2
12	9606.ENSP00000290015	0.911	Protein Wnt-9b
13	9606.ENSP00000325526	0.911	Protein Wnt-11
14	9606.ENSP00000264634	0.910	Protein Wnt-5a
15	9606.ENSP00000341032	0.909	Protein Wnt-7b
16	9606.ENSP00000358698	0.909	Protein Wnt-2b
17	9606.ENSP00000380379	0.909	Protein Wnt-5b
18	9606.ENSP00000284523	0.908	Protein Wnt-3a
19	9606.ENSP00000285018	0.908	Protein Wnt-7a
20	9606.ENSP00000225512	0.907	Proto-oncogene Wnt-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0098772	0.985	molecular function regulator activity
GO:0048018	0.974	receptor ligand activity
GO:0005109	0.526	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0023052	0.987	signaling
GO:0007154	0.987	cell communication
GO:0007275	0.987	multicellular organism development
GO:0198738	0.981	cell-cell signaling by wnt
GO:0007165	0.978	signal transduction
GO:0050793	0.972	regulation of developmental process
GO:0016055	0.966	Wnt signaling pathway
GO:0048731	0.965	system development
GO:0048518	0.933	positive regulation of biological process
GO:0060070	0.925	canonical Wnt signaling pathway
GO:0048513	0.917	animal organ development
GO:0009888	0.892	tissue development
GO:0030154	0.892	cell differentiation
GO:0048522	0.888	positive regulation of cellular process
GO:0019222	0.872	regulation of metabolic process
GO:0060255	0.864	regulation of macromolecule metabolic process
GO:0045596	0.810	negative regulation of cell differentiation
GO:0051171	0.783	regulation of nitrogen compound metabolic process
GO:0080090	0.773	regulation of primary metabolic process
GO:0031323	0.773	regulation of cellular metabolic process
GO:0009893	0.754	positive regulation of metabolic process
GO:0008283	0.726	cell population proliferation
GO:0072089	0.712	stem cell proliferation
GO:0045598	0.698	regulation of fat cell differentiation
GO:0009653	0.697	anatomical structure morphogenesis
GO:0010604	0.693	positive regulation of macromolecule metabolic process
GO:0010468	0.687	regulation of gene expression
GO:0048583	0.636	regulation of response to stimulus
GO:0023051	0.632	regulation of signaling
GO:0010646	0.626	regulation of cell communication
GO:0045599	0.620	negative regulation of fat cell differentiation
GO:0009966	0.608	regulation of signal transduction
GO:0009889	0.578	regulation of biosynthetic process
GO:0019219	0.576	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.572	regulation of macromolecule biosynthetic process
GO:0031326	0.571	regulation of cellular biosynthetic process
GO:0051252	0.565	regulation of RNA metabolic process
GO:0006355	0.561	regulation of DNA-templated transcription
GO:0051173	0.560	positive regulation of nitrogen compound metabolic process
GO:0042127	0.525	regulation of cell population proliferation
GO:0031325	0.525	positive regulation of cellular metabolic process
GO:0051239	0.501	regulation of multicellular organismal process
GO:0009891	0.368	positive regulation of biosynthetic process
GO:0009892	0.367	negative regulation of metabolic process
GO:0045935	0.364	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.361	positive regulation of cellular biosynthetic process
GO:0010557	0.359	positive regulation of macromolecule biosynthetic process
GO:1902680	0.348	positive regulation of RNA biosynthetic process
GO:0010605	0.339	negative regulation of macromolecule metabolic process
GO:0048584	0.338	positive regulation of response to stimulus
GO:1903508	0.337	positive regulation of nucleic acid-templated transcription
GO:0065009	0.332	regulation of molecular function
GO:0051094	0.328	positive regulation of developmental process
GO:0045893	0.324	positive regulation of DNA-templated transcription
GO:0007399	0.304	nervous system development
GO:2000026	0.301	regulation of multicellular organismal development
GO:0009887	0.300	animal organ morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0071944	0.934	cell periphery
GO:0005622	0.851	intracellular anatomical structure
GO:0016020	0.825	membrane
GO:0005737	0.800	cytoplasm
GO:0043226	0.792	organelle
GO:0043227	0.778	membrane-bounded organelle
GO:0043229	0.734	intracellular organelle
GO:0043231	0.711	intracellular membrane-bounded organelle
GO:0005886	0.627	plasma membrane
GO:0012505	0.625	endomembrane system
GO:0070013	0.579	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]