StarFunc result for job id O00750

User Input

>input (1634 residues)
MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISW
DEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPK
GSLSGDYLYIFDGSDGGVSSSPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSS
SKISQPSDINTFSLVEQLPGKLLEHRILEEEEVLGGGGQGRLLGSVDYDGINDAITRLNL
KSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTMPPQVPPRTYASRYGNRKNAT
PGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGY
VWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCYTHDDLRNVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDIDIRLQLMEQKVVRSDLARTVNDDQS
PSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAIC
NALAAVETPEITSALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELY
CNTFNADFQTAVPGSRKHDLVQEACHFARSLAFTVYATHRIPIIWATSYEDFYLSCSLSH
GGKELCSPLQTRRAHFSKYLFHLIVWDQQICFPVQVNRLPRETLLCATLYALPIPPPGSS
SEANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQENPSARWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPPGDKFSPRYEFGSLREEDQRKLKDIMQKESLYWLTDADKKRLW
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYVLLKQWTHMNHQDALGLLHATFPDQEVR
RMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNALAKLAQQVREAAPSARQGILR
TGLEEVKQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENIRV
IFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAETLRK
IQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDN
IMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDL
CCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLI
ESSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFASRTHTLKSSGRISDVFLCRHEKIFH
PNKGYIYVVKVMRENTHEATYIQRTFEEFQELHNKLRLLFPSSHLPSFPSRFVIGRSRGE
AVAERRREELNGYIWHLIHAPPEVAECDLVYTFFHPLPRDEKAMGTSPAPKSSDGTWARP
VGKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKRKTKV
ARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVNIRLRELDLAQEK
TGWFALGSRSHGTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00750	1.000	1.000	0.000	1634	1.000	1.000	O00750.pdb.gz	P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=1 SV=2
2	PDB:7lq1A	0.447	0.752	1.698E-48	950	0.146	0.251	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
3	PDB:5itdA	0.446	0.715	1.015E-47	995	0.163	0.267	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
4	PDB:6pyuA	0.438	0.754	2.742E-47	930	0.145	0.255	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
5	PDB:5dxtA	0.448	0.809	5.607E-47	879	0.166	0.309	5dxtA.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
6	PDB:5dxhD	0.442	0.722	1.241E-46	981	0.160	0.266	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
7	PDB:7mezA	0.460	0.740	1.706E-46	989	0.166	0.274	7mezA.pdb.gz
8	PDB:4yknA	0.452	0.604	2.253E-46	1205	0.163	0.222	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
9	PDB:4ajwB	0.425	0.852	2.005E-45	792	0.143	0.295	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
10	PDB:6gy0A	0.430	0.828	2.350E-45	822	0.146	0.291	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
11	PDB:5swpA	0.459	0.693	3.940E-45	1060	0.165	0.255	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
12	AFDB:Q54F55	0.424	0.383	2.297E-41	1820	0.168	0.151	Q54F55.pdb.gz	Q54F55_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=pikH PE=3 SV=1
13	AFDB:Q62768	0.076	0.073	2.003E-15	1735	0.138	0.130	Q62768.pdb.gz	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
14	AFDB:Q22366	0.078	0.082	9.659E-5	1563	0.026	0.027	Q22366.pdb.gz	RIM_CAEEL Rab-3-interacting molecule unc-10 OS=Caenorhabditis elegans OX=6239 GN=unc-10 PE=2 SV=2
15	AFDB:Q99N50	0.077	0.132	1.046E-4	950	0.031	0.053	Q99N50.pdb.gz	SYTL2_MOUSE Synaptotagmin-like protein 2 OS=Mus musculus OX=10090 GN=Sytl2 PE=1 SV=2
16	AFDB:P59764	0.072	0.061	1.232E-2	1978	0.078	0.065	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
17	AFDB:Q57W20	0.085	0.098	1.447E-1	1370	0.072	0.086	Q57W20.pdb.gz	Q57W20_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28I8.20 PE=4 SV=1
18	AFDB:P08678	0.050	0.041	1.506E-1	2026	0.039	0.032	P08678.pdb.gz	CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYR1 PE=1 SV=2
19	AFDB:Q54I36	0.092	0.106	1.837E-1	1338	0.099	0.120	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
20	AFDB:Q08236	0.045	0.061	2.525E-1	1176	0.042	0.058	Q08236.pdb.gz	AVO1_YEAST Target of rapamycin complex 2 subunit AVO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVO1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RSK1	0.0	1259	688	0.379	0.901	A2RSK1_MOUSE Pik3c2b protein OS=Mus musculus OX=10090 GN=Pik3c2b PE=2 SV=1
2	A2RUF7	0.0	3402	1634	1.000	1.000	A2RUF7_HUMAN Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=2 SV=1
3	E9QAN8	0.0	3148	1632	0.936	0.938	E9QAN8_MOUSE Phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta OS=Mus musculus OX=10090 GN=Pik3c2b PE=1 SV=1
4	F5GWN5	0.0	3327	1606	0.983	1.000	F5GWN5_HUMAN Phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=1 SV=1
5	F6NMW9	0.0	1330	1685	0.417	0.404	F6NMW9_DANRE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X2 OS=Danio rerio OX=7955 GN=pik3c2a PE=1 SV=1
6	L7RRS0	0.0	1373	1686	0.422	0.409	L7RRS0_HUMAN Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=3 SV=1
7	O00443	0.0	1373	1686	0.422	0.409	P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2
8	O00750	0.0	3402	1634	1.000	1.000	P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=1 SV=2
9	O70167	0.0	824	1506	0.300	0.326	P3C2G_MOUSE Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Mus musculus OX=10090 GN=Pik3c2g PE=1 SV=1
10	O70173	0.0	816	1505	0.301	0.327	P3C2G_RAT Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3c2g PE=1 SV=1
11	O75747	0.0	809	1445	0.299	0.338	P3C2G_HUMAN Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens OX=9606 GN=PIK3C2G PE=1 SV=3
12	Q61194	0.0	1370	1686	0.428	0.415	P3C2A_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Mus musculus OX=10090 GN=Pik3c2a PE=1 SV=2
13	Q7JNX6	0.0	834	1876	0.310	0.270	Q7JNX6_DROME Phosphoinositide 3-kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K68D PE=2 SV=1
14	Q7K3H0	0.0	832	1876	0.309	0.269	Q7K3H0_DROME LD28067p OS=Drosophila melanogaster OX=7227 GN=Pi3K68D PE=2 SV=1
15	Q9VTN5	0.0	832	1876	0.310	0.270	Q9VTN5_DROME Phosphoinositide 3-kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K68D PE=2 SV=2
16	D3Z091	1.44e-166	507	310	0.161	0.848	D3Z091_MOUSE Phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta (Fragment) OS=Mus musculus OX=10090 GN=Pik3c2b PE=1 SV=1
17	G5EDY0	8.74e-157	522	1607	0.235	0.239	PIKI1_CAEEL Phosphatidylinositol 3-kinase piki-1 OS=Caenorhabditis elegans OX=6239 GN=piki-1 PE=1 SV=1
18	Q55FX5	3.88e-137	462	1382	0.166	0.196	Q55FX5_DICDI Phosphatidylinositol 3-kinase OS=Dictyostelium discoideum OX=44689 GN=pikF PE=3 SV=1
19	P54675	2.35e-130	449	1697	0.159	0.153	PI3K3_DICDI Phosphatidylinositol 3-kinase 3 OS=Dictyostelium discoideum OX=44689 GN=pikC PE=2 SV=2
20	P54673	1.19e-126	436	1571	0.151	0.157	PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum OX=44689 GN=pikA PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	3.3e-14	64.4	C2 domain
2	PF13575 DUF4135	27	15.5	Domain of unknown function (DUF4135)
3	PF13646 HEAT_2	64	15.4	HEAT repeats
4	PF00613 PI3Ka	4.5e-34	129.0	Phosphoinositide 3-kinase family, accessory domain (PIK domain)
5	PF00792 PI3K_C2	6.5e-30	115.3	Phosphoinositide 3-kinase C2
6	PF00794 PI3K_rbd	2.3e-25	100.2	PI3-kinase family, ras-binding domain
7	PF00454 PI3_PI4_kinase	1e-53	194.3	Phosphatidylinositol 3- and 4-kinase
8	PF00787 PX	8.3e-11	53.8	PX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356155

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428056	0.961	Phosphatidylinositol 3-kinase regulatory subunit alpha
2	9606.ENSP00000074304	0.948	Type I inositol 3,4-bisphosphate 4-phosphatase
3	9606.ENSP00000361021	0.947	Phosphatase and tensin homolog
4	9606.ENSP00000288135	0.945	Mast/stem cell growth factor receptor Kit
5	9606.ENSP00000425487	0.944	Type II inositol 3,4-bisphosphate 4-phosphatase
6	9606.ENSP00000376345	0.943	Growth factor receptor-bound protein 2
7	9606.ENSP00000264380	0.939	1-phosphatidylinositol 3-phosphate 5-kinase
8	9606.ENSP00000275493	0.938	Epidermal growth factor receptor
9	9606.ENSP00000298229	0.936	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
10	9606.ENSP00000222254	0.927	Phosphatidylinositol 3-kinase regulatory subunit beta
11	9606.ENSP00000373713	0.927	Phosphatidylinositide phosphatase SAC1
12	9606.ENSP00000262741	0.926	Phosphatidylinositol 3-kinase regulatory subunit gamma
13	9606.ENSP00000264864	0.926	Phosphatidylinositol 4-kinase type 2-beta
14	9606.ENSP00000354519	0.926	Phosphatidylinositide phosphatase SAC2
15	9606.ENSP00000263967	0.925	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
16	9606.ENSP00000219789	0.923	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
17	9606.ENSP00000255882	0.922	Phosphatidylinositol 4-kinase alpha
18	9606.ENSP00000357869	0.922	Phosphatidylinositol 4-kinase beta
19	9606.ENSP00000359665	0.918	Phosphatidylinositol 4-kinase type 2-alpha
20	9606.ENSP00000405338	0.913	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016307	1.000	phosphatidylinositol phosphate kinase activity
GO:0016303	1.000	1-phosphatidylinositol-3-kinase activity
GO:0035005	0.835	1-phosphatidylinositol-4-phosphate 3-kinase activity
GO:0001727	0.618	lipid kinase activity
GO:0019899	0.493	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0046854	0.987	phosphatidylinositol phosphate biosynthetic process
GO:0050794	0.982	regulation of cellular process
GO:0009605	0.972	response to external stimulus
GO:0016043	0.955	cellular component organization
GO:0051716	0.931	cellular response to stimulus
GO:0007154	0.917	cell communication
GO:1905037	0.880	autophagosome organization
GO:0023052	0.866	signaling
GO:0007165	0.851	signal transduction
GO:0035556	0.706	intracellular signal transduction
GO:0043491	0.700	protein kinase B signaling
GO:0006950	0.672	response to stress
GO:0009267	0.615	cellular response to starvation
GO:0048518	0.438	positive regulation of biological process
GO:0048522	0.342	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.996	nucleoplasm
GO:0016020	0.981	membrane
GO:0071944	0.858	cell periphery
GO:0005886	0.842	plasma membrane
GO:0031982	0.650	vesicle
GO:0031410	0.324	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12709	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+)
EC:2.7.1.137	1.000	phosphatidylinositol 3-kinase.
RHEA:18373	0.835	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+)
EC:2.7.1.154	0.835	phosphatidylinositol-4-phosphate 3-kinase.

[back to server]