StarFunc result for job id O00754

User Input

>input (1011 residues)
MGAYARASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGARAGGYETCPTVQP
NMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVE
IAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLE
DTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWR
ASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVA
TAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVHVLYSTPACYL
WELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVG
LAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNAL
ARLRGFKDHFTFCQQLNISICPLSQTAARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDP
NGRTVPSDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRS
WSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGAY
IFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQVVRLYPGQRHLELEWSVGPIP
VGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNT
RIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLLKDDGRGVSEPLMENGSGAWVRG
RHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPSV
HLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQ
LREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTFLASVQWKEVDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00754	1.000	1.000	0.000	1011	1.000	1.000	O00754.pdb.gz	MA2B1_HUMAN Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3
2	AFDB:O09159	0.948	0.946	0.000	1013	0.753	0.751	O09159.pdb.gz	MA2B1_MOUSE Lysosomal alpha-mannosidase OS=Mus musculus OX=10090 GN=Man2b1 PE=1 SV=4
3	AFDB:Q29451	0.936	0.948	0.000	999	0.797	0.807	Q29451.pdb.gz	MA2B1_BOVIN Lysosomal alpha-mannosidase OS=Bos taurus OX=9913 GN=MAN2B1 PE=1 SV=4
4	AFDB:Q6P762	0.946	0.948	0.000	1009	0.745	0.746	Q6P762.pdb.gz	Q6P762_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=2 SV=1
5	AFDB:Q8IPB7	0.894	0.838	0.000	1080	0.444	0.416	Q8IPB7.pdb.gz	Q8IPB7_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManII PE=1 SV=1
6	AFDB:Q8LPJ3	0.888	0.877	2.291E-103	1024	0.395	0.390	Q8LPJ3.pdb.gz	MANA2_ARATH Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
7	AFDB:P34098	0.884	0.884	7.342E-101	1010	0.363	0.363	P34098.pdb.gz	MANA_DICDI Lysosomal alpha-mannosidase OS=Dictyostelium discoideum OX=44689 GN=manA PE=1 SV=2
8	AFDB:Q9VKV2	0.873	0.928	3.068E-100	950	0.399	0.424	Q9VKV2.pdb.gz	Q9VKV2_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManI PE=3 SV=1
9	AFDB:P94078	0.883	0.876	6.856E-99	1019	0.391	0.388	P94078.pdb.gz	MANA1_ARATH Alpha-mannosidase At3g26720 OS=Arabidopsis thaliana OX=3702 GN=At3g26720 PE=1 SV=1
10	AFDB:Q38BY8	0.823	0.834	4.616E-86	997	0.332	0.337	Q38BY8.pdb.gz	Q38BY8_TRYB2 Alpha-mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5100 PE=3 SV=1
11	PDB:6rrnA	0.775	0.791	3.620E-64	989	0.228	0.234	6rrnA.pdb.gz	Manno- epi -cyclophellitols Enable Activity-Based Protein Profiling of Human alpha-Mannosidases and Discovery of New Golgi Mannosidase II Inhibitors.
12	PDB:3bubA	0.771	0.767	2.872E-63	1016	0.229	0.228	3bubA.pdb.gz	Probing the substrate specificity of Golgi alpha-mannosidase II by use of synthetic oligosaccharides and a catalytic nucleophile mutant.
13	PDB:7vqoA	0.606	0.527	5.137E-31	1180	0.141	0.121	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
14	PDB:7dd9A	0.607	0.549	1.267E-29	1129	0.133	0.119	7dd9A.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
15	PDB:5jm0A	0.579	0.618	1.722E-25	940	0.121	0.130	5jm0A.pdb.gz
16	PDB:3p0bA	0.257	0.451	6.149E-6	511	0.056	0.112	3p0bA.pdb.gz
17	PDB:6al2A	0.154	0.283	1.354E-5	484	0.028	0.058	6al2A.pdb.gz
18	PDB:6drvA	0.151	0.149	2.250E-4	1024	0.046	0.046	6drvA.pdb.gz
19	PDB:5mg3C	0.151	0.297	2.483E-4	455	0.024	0.053	5mg3C.pdb.gz
20	PDB:5aedA	0.134	0.184	1.395E-3	674	0.031	0.046	5aedA.pdb.gz	Yihq is a Sulfoquinovosidase that Cleaves Sulfoquinovosyl Diacylglyceride Sulfolipids.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7FG85	0.0	1560	1020	0.746	0.739	F7FG85_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=1 SV=1
2	O00754	0.0	2096	1011	1.000	1.000	MA2B1_HUMAN Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3
3	O09159	0.0	1575	1013	0.756	0.754	MA2B1_MOUSE Lysosomal alpha-mannosidase OS=Mus musculus OX=10090 GN=Man2b1 PE=1 SV=4
4	P34098	0.0	647	1010	0.379	0.379	MANA_DICDI Lysosomal alpha-mannosidase OS=Dictyostelium discoideum OX=44689 GN=manA PE=1 SV=2
5	P94078	0.0	700	1019	0.406	0.402	MANA1_ARATH Alpha-mannosidase At3g26720 OS=Arabidopsis thaliana OX=3702 GN=At3g26720 PE=1 SV=1
6	Q29451	0.0	1638	999	0.801	0.811	MA2B1_BOVIN Lysosomal alpha-mannosidase OS=Bos taurus OX=9913 GN=MAN2B1 PE=1 SV=4
7	Q6P762	0.0	1568	1009	0.747	0.748	Q6P762_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=2 SV=1
8	Q8IPB7	0.0	846	1080	0.443	0.415	Q8IPB7_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManII PE=1 SV=1
9	Q8LPJ3	0.0	710	1024	0.407	0.401	MANA2_ARATH Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
10	Q9VKV1	0.0	847	1080	0.444	0.416	Q9VKV1_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManII PE=1 SV=2
11	Q9VKV2	0.0	753	950	0.414	0.441	Q9VKV2_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManI PE=3 SV=1
12	Q38BY8	4.37e-153	481	997	0.335	0.340	Q38BY8_TRYB2 Alpha-mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5100 PE=3 SV=1
13	Q8BRK9	6.39e-83	294	1152	0.290	0.254	MA2A2_MOUSE Alpha-mannosidase 2x OS=Mus musculus OX=10090 GN=Man2a2 PE=1 SV=2
14	A0A0G2K8F6	4.31e-82	290	1021	0.288	0.285	A0A0G2K8F6_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=2
15	Q16706	2.19e-81	289	1144	0.269	0.238	MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2
16	Q9Y2E5	2.88e-81	287	1009	0.292	0.292	MA2B2_HUMAN Epididymis-specific alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B2 PE=1 SV=4
17	Q9LFR0	2.22e-80	287	1173	0.285	0.246	GMAN2_ARATH Alpha-mannosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GMII PE=1 SV=1
18	O54782	2.34e-80	285	1018	0.288	0.286	MA2B2_MOUSE Epididymis-specific alpha-mannosidase OS=Mus musculus OX=10090 GN=Man2b2 PE=1 SV=2
19	P49641	8.52e-80	285	1150	0.286	0.251	MA2A2_HUMAN Alpha-mannosidase 2x OS=Homo sapiens OX=9606 GN=MAN2A2 PE=2 SV=3
20	B5DEJ3	1.22e-79	282	1004	0.281	0.283	B5DEJ3_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09261 Alpha-mann_mid	3.7e-17	73.6	Alpha mannosidase middle domain
2	PF17677 Glyco_hydro38C2	1.7e-08	45.8	Glycosyl hydrolases family 38 C-terminal beta sandwich domain
3	PF07748 Glyco_hydro_38C	1.7e-53	193.5	Glycosyl hydrolases family 38 C-terminal domain
4	PF01074 Glyco_hydro_38N	1.7e-93	324.7	Glycosyl hydrolases family 38 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395473

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457788	0.982	Alpha-mannosidase 2C1
2	9606.ENSP00000226578	0.940	Beta-mannosidase
3	9606.ENSP00000285599	0.842	Epididymis-specific alpha-mannosidase
4	9606.ENSP00000306920	0.722	Beta-galactosidase
5	9606.ENSP00000357149	0.720	T-cell surface glycoprotein CD1e, membrane-associated
6	9606.ENSP00000302728	0.677	Beta-glucuronidase
7	9606.ENSP00000447378	0.675	Maltase-glucoamylase, intestinal
8	9606.ENSP00000379680	0.654	Alpha-N-acetylgalactosaminidase
9	9606.ENSP00000305692	0.648	Lysosomal alpha-glucosidase
10	9606.ENSP00000333310	0.638	Sulfotransferase 1C3
11	9606.ENSP00000404718	0.635	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
12	9606.ENSP00000299314	0.633	N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
13	9606.ENSP00000363603	0.625	Tissue alpha-L-fucosidase
14	9606.ENSP00000357150	0.606	T-cell surface glycoprotein CD1b
15	9606.ENSP00000359664	0.606	Di-N-acetylchitobiase
16	9606.ENSP00000256497	0.591	ER degradation-enhancing alpha-mannosidase-like protein 1
17	9606.ENSP00000257264	0.570	Transcobalamin-1
18	9606.ENSP00000272902	0.568	Sulfatase-modifying factor 1
19	9606.ENSP00000360645	0.565	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
20	9606.ENSP00000264382	0.554	Sucrase-isomaltase, intestinal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004559	1.000	alpha-mannosidase activity
GO:0005488	0.998	binding
GO:0046872	0.752	metal ion binding
GO:0046914	0.744	transition metal ion binding
GO:0005515	0.724	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0009100	0.986	glycoprotein metabolic process
GO:0036211	0.981	protein modification process
GO:0006517	0.961	protein deglycosylation
GO:1901575	0.341	organic substance catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005764	0.999	lysosome
GO:0012505	0.998	endomembrane system
GO:0070013	0.998	intracellular organelle lumen
GO:0070062	0.995	extracellular exosome
GO:0005766	0.977	primary lysosome
GO:0042582	0.970	azurophil granule
GO:0031983	0.949	vesicle lumen
GO:0043202	0.949	lysosomal lumen
GO:0034774	0.937	secretory granule lumen
GO:0035578	0.775	azurophil granule lumen
GO:0031981	0.679	nuclear lumen
GO:0005654	0.640	nucleoplasm
GO:0016020	0.538	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.24	1.000	alpha-mannosidase.

[back to server]