StarFunc result for job id O00755

User Input

>input (349 residues)
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0R9D3	0.912	0.912	1.879E-61	349	0.991	0.991	M0R9D3.pdb.gz	M0R9D3_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7a PE=3 SV=1
2	AFDB:Q3L254	0.919	0.919	2.905E-54	349	0.794	0.794	Q3L254.pdb.gz	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
3	AFDB:A0A0G2K3B7	0.915	0.904	3.569E-52	353	0.762	0.754	A0A0G2K3B7.pdb.gz	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
4	AFDB:P28465	0.852	0.845	4.708E-39	352	0.476	0.472	P28465.pdb.gz	WNT2_DROME Protein Wnt-2 OS=Drosophila melanogaster OX=7227 GN=Wnt2 PE=2 SV=2
5	AFDB:B0S7E3	0.840	0.745	3.448E-37	396	0.484	0.427	B0S7E3.pdb.gz
6	AFDB:B3DFK5	0.830	0.752	7.114E-37	387	0.481	0.434	B3DFK5.pdb.gz
7	AFDB:Q93097	0.832	0.747	2.462E-36	391	0.493	0.440	Q93097.pdb.gz	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
8	AFDB:P49337	0.824	0.820	1.851E-35	351	0.461	0.459	P49337.pdb.gz	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
9	AFDB:Q92048	0.820	0.818	1.851E-35	350	0.433	0.431	Q92048.pdb.gz	WNT2_DANRE Protein Wnt-2 OS=Danio rerio OX=7955 GN=wnt2 PE=2 SV=1
10	AFDB:F1QK98	0.819	0.785	2.800E-35	365	0.441	0.422	F1QK98.pdb.gz
11	PDB:6ahyB	0.792	0.877	3.267E-31	313	0.433	0.482	6ahyB.pdb.gz
12	PDB:4f0aB	0.683	0.802	1.250E-24	294	0.324	0.384	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:6ymvA	0.097	0.055	2.897E-1	887	0.083	0.033	6ymvA.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
14	PDB:1tt9A	0.123	0.088	1.003	540	0.054	0.035	1tt9A.pdb.gz
15	PDB:6sb3A	0.076	0.047	1.003	604	0.017	0.010	6sb3A.pdb.gz
16	PDB:7taoD	0.108	0.201	1.056	158	0.037	0.082	7taoD.pdb.gz	Cryo-EM of the Yeast V O Complex Reveals Distinct Binding Sites for Macrolide V-ATPase Inhibitors.
17	PDB:3b07B	0.085	0.106	1.299	270	0.006	0.007	3b07B.pdb.gz
18	PDB:6ymwA	0.177	0.094	1.367	913	0.080	0.031	6ymwA.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
19	PDB:3zqqC	0.094	0.200	1.517	134	0.032	0.082	3zqqC.pdb.gz
20	PDB:6wlw0	0.110	0.166	1.682	204	0.072	0.123	6wlw0.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3B7	0.0	578	353	0.779	0.771	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
2	M0R9D3	0.0	723	349	0.991	0.991	M0R9D3_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7a PE=3 SV=1
3	O00755	0.0	729	349	1.000	1.000	WNT7A_HUMAN Protein Wnt-7a OS=Homo sapiens OX=9606 GN=WNT7A PE=1 SV=2
4	P24383	0.0	725	349	0.994	0.994	WNT7A_MOUSE Protein Wnt-7a OS=Mus musculus OX=10090 GN=Wnt7a PE=1 SV=2
5	P28047	0.0	595	349	0.785	0.785	WNT7B_MOUSE Protein Wnt-7b OS=Mus musculus OX=10090 GN=Wnt7b PE=1 SV=1
6	P56706	0.0	594	349	0.779	0.779	WNT7B_HUMAN Protein Wnt-7b OS=Homo sapiens OX=9606 GN=WNT7B PE=1 SV=2
7	Q3L254	0.0	605	349	0.794	0.794	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
8	Q5NSW6	0.0	595	349	0.785	0.785	Q5NSW6_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=2 SV=1
9	Q9DEB8	0.0	695	349	0.940	0.940	Q9DEB8_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT7A PE=2 SV=1
10	Q98SN7	2.39e-115	341	385	0.493	0.447	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
11	Q93097	2.47e-113	336	391	0.476	0.425	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
12	O70283	2.49e-113	336	389	0.476	0.427	WNT2B_MOUSE Protein Wnt-2b OS=Mus musculus OX=10090 GN=Wnt2b PE=2 SV=3
13	P56705	6.08e-113	334	351	0.453	0.450	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
14	P22724	1.06e-112	333	351	0.453	0.450	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
15	Q9QXQ5	2.08e-112	332	351	0.450	0.447	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
16	P47793	3.12e-112	332	352	0.476	0.472	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
17	Q1L130	2.76e-111	331	396	0.473	0.417	Q1L130_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2bb PE=2 SV=1
18	P49338	1.14e-110	328	351	0.444	0.442	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
19	Q8AY89	2.75e-110	328	387	0.470	0.424	Q8AY89_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2b PE=2 SV=1
20	P49337	3.79e-110	327	351	0.450	0.447	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06419 COG6	8e+02	9.6	Conserved oligomeric complex COG6
2	PF00110 wnt	5.4e-120	412.2	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010382776.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010384367.1	0.965	Belongs to the G-protein coupled receptor Fz/Smo family.
2	61622.XP_010385200.1	0.947	Belongs to the G-protein coupled receptor Fz/Smo family.
3	61622.XP_010364779.1	0.941	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
4	61622.XP_010369300.1	0.937	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
5	61622.XP_010354330.1	0.920	Belongs to the G-protein coupled receptor Fz/Smo family.
6	61622.XP_010353283.1	0.919	Belongs to the G-protein coupled receptor Fz/Smo family.
7	61622.XP_010385211.1	0.915	Wnt inhibitory factor 1
8	61622.XP_010385756.1	0.914	Belongs to the G-protein coupled receptor Fz/Smo family.
9	61622.XP_010352284.1	0.903	Belongs to the G-protein coupled receptor Fz/Smo family.
10	61622.XP_010359407.1	0.898	Belongs to the membrane-bound acyltransferase family.
11	61622.XP_010380021.1	0.889	Secreted frizzled-related protein 4
12	61622.XP_010352954.1	0.880	Frizzled-1
13	61622.XP_010352827.1	0.858	Belongs to the G-protein coupled receptor Fz/Smo family.
14	61622.XP_010369211.1	0.857	Belongs to the G-protein coupled receptor Fz/Smo family.
15	61622.XP_010352909.1	0.855	Secreted frizzled-related protein 1
16	61622.XP_010381195.1	0.844	Secreted frizzled-related protein 2
17	61622.XP_010387843.1	0.844	Secreted frizzled-related protein 5
18	61622.XP_010379901.1	0.839	Dickkopf WNT signaling pathway inhibitor 1
19	61622.XP_010363153.1	0.772	Tyrosine-protein kinase RYK
20	61622.XP_010355368.1	0.766	Wntless Wnt ligand secretion mediator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005109	1.000	frizzled binding
GO:0140677	0.968	molecular function activator activity
GO:0048018	0.955	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.985	multicellular organismal process
GO:0048856	0.985	anatomical structure development
GO:0050896	0.983	response to stimulus
GO:0050794	0.981	regulation of cellular process
GO:0198738	0.977	cell-cell signaling by wnt
GO:0048731	0.975	system development
GO:0016055	0.973	Wnt signaling pathway
GO:0048518	0.972	positive regulation of biological process
GO:0048513	0.963	animal organ development
GO:0009653	0.910	anatomical structure morphogenesis
GO:0048522	0.896	positive regulation of cellular process
GO:0048869	0.890	cellular developmental process
GO:0030154	0.884	cell differentiation
GO:0060070	0.883	canonical Wnt signaling pathway
GO:0009888	0.874	tissue development
GO:0019222	0.870	regulation of metabolic process
GO:0060255	0.861	regulation of macromolecule metabolic process
GO:0007399	0.854	nervous system development
GO:0048519	0.813	negative regulation of biological process
GO:0010468	0.810	regulation of gene expression
GO:0009893	0.807	positive regulation of metabolic process
GO:0051171	0.788	regulation of nitrogen compound metabolic process
GO:0031323	0.781	regulation of cellular metabolic process
GO:0080090	0.779	regulation of primary metabolic process
GO:0060322	0.774	head development
GO:0048584	0.767	positive regulation of response to stimulus
GO:0048523	0.759	negative regulation of cellular process
GO:0010604	0.759	positive regulation of macromolecule metabolic process
GO:0042221	0.746	response to chemical
GO:0009967	0.746	positive regulation of signal transduction
GO:0071840	0.740	cellular component organization or biogenesis
GO:0016043	0.732	cellular component organization
GO:0042127	0.714	regulation of cell population proliferation
GO:0007417	0.710	central nervous system development
GO:0030182	0.680	neuron differentiation
GO:0120039	0.676	plasma membrane bounded cell projection morphogenesis
GO:0009889	0.613	regulation of biosynthetic process
GO:0019219	0.610	regulation of nucleobase-containing compound metabolic process
GO:0060429	0.599	epithelium development
GO:0048468	0.579	cell development
GO:0010556	0.563	regulation of macromolecule biosynthetic process
GO:0031326	0.559	regulation of cellular biosynthetic process
GO:0031325	0.553	positive regulation of cellular metabolic process
GO:0051173	0.549	positive regulation of nitrogen compound metabolic process
GO:0051252	0.548	regulation of RNA metabolic process
GO:0006355	0.539	regulation of DNA-templated transcription
GO:0050793	0.535	regulation of developmental process
GO:0002088	0.521	lens development in camera-type eye
GO:0051239	0.498	regulation of multicellular organismal process
GO:0030855	0.456	epithelial cell differentiation
GO:1902531	0.421	regulation of intracellular signal transduction
GO:0031175	0.397	neuron projection development
GO:0031328	0.391	positive regulation of cellular biosynthetic process
GO:0045935	0.388	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.358	positive regulation of macromolecule biosynthetic process
GO:0007420	0.356	brain development
GO:1903508	0.339	positive regulation of nucleic acid-templated transcription
GO:1902533	0.326	positive regulation of intracellular signal transduction
GO:0045893	0.326	positive regulation of DNA-templated transcription
GO:0065008	0.311	regulation of biological quality
GO:0045595	0.311	regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0070013	0.996	intracellular organelle lumen
GO:0071944	0.995	cell periphery
GO:0016020	0.994	membrane
GO:0005886	0.969	plasma membrane
GO:0005783	0.949	endoplasmic reticulum
GO:0005615	0.942	extracellular space
GO:0005788	0.874	endoplasmic reticulum lumen
GO:0031982	0.867	vesicle
GO:0031090	0.863	organelle membrane
GO:0031410	0.766	cytoplasmic vesicle
GO:0030054	0.746	cell junction
GO:0098978	0.681	glutamatergic synapse
GO:0098588	0.509	bounding membrane of organelle
GO:1903561	0.506	extracellular vesicle
GO:0031981	0.494	nuclear lumen
GO:0005794	0.471	Golgi apparatus
GO:0012506	0.428	vesicle membrane
GO:0030659	0.423	cytoplasmic vesicle membrane
GO:0070062	0.414	extracellular exosome
GO:0009986	0.412	cell surface
GO:0030139	0.411	endocytic vesicle
GO:0005654	0.402	nucleoplasm
GO:0030666	0.382	endocytic vesicle membrane
GO:0030312	0.366	external encapsulating structure
GO:0005796	0.357	Golgi lumen
GO:0031012	0.352	extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]