StarFunc result for job id O00757

User Input

>input (339 residues)
MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGI
AGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDP
LDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQ
GVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAP
YGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGT
QPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00757	1.000	1.000	1.961E-73	339	1.000	1.000	O00757.pdb.gz	F16P2_HUMAN Fructose-1,6-bisphosphatase isozyme 2 OS=Homo sapiens OX=9606 GN=FBP2 PE=1 SV=2
2	AFDB:Q7T337	0.978	0.984	5.220E-65	337	0.761	0.766	Q7T337.pdb.gz	Q7T337_DANRE fructose-bisphosphatase OS=Danio rerio OX=7955 GN=cb598 PE=1 SV=1
3	AFDB:A0A060XAF0	0.978	0.983	8.367E-65	337	0.752	0.757	A0A060XAF0.pdb.gz	A0A060XAF0_ONCMY fructose-bisphosphatase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00063051001 PE=3 SV=1
4	PDB:5q0cA	0.914	0.944	2.842E-64	328	0.962	0.994	5q0cA.pdb.gz	Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[5-(4-methoxyphenyl)thiophen-2-yl]sulfonylurea and with f2,6p
5	AFDB:P00637	0.981	0.984	4.111E-64	338	0.749	0.751	P00637.pdb.gz	F16P1_RABIT Fructose-1,6-bisphosphatase 1 OS=Oryctolagus cuniculus OX=9986 GN=FBP1 PE=1 SV=4
6	AFDB:P19112	0.996	0.930	4.907E-64	363	0.746	0.697	P19112.pdb.gz	F16P1_RAT Fructose-1,6-bisphosphatase 1 OS=Rattus norvegicus OX=10116 GN=Fbp1 PE=1 SV=2
7	PDB:7ezfD	0.908	0.935	1.216E-56	329	0.749	0.772	7ezfD.pdb.gz	Discovery of Novel Indole Derivatives as Fructose-1,6-bisphosphatase Inhibitors and X-ray Cocrystal Structures Analysis.
8	PDB:1bk4A	0.912	0.984	6.684E-54	314	0.693	0.748	1bk4A.pdb.gz	Structure of rabbit liver fructose 1,6-bisphosphatase at 2.3 A resolution.
9	PDB:5k55A	0.821	0.958	1.010E-53	290	0.841	0.983	5k55A.pdb.gz	Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase.
10	AFDB:Q9MA79	0.965	0.959	3.135E-52	341	0.534	0.531	Q9MA79.pdb.gz	F16P2_ARATH Fructose-1,6-bisphosphatase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=CYFBP PE=1 SV=1
11	AFDB:Q6RYT0	0.958	0.938	8.982E-49	346	0.454	0.445	Q6RYT0.pdb.gz	F16P_DICDI Fructose-1,6-bisphosphatase OS=Dictyostelium discoideum OX=44689 GN=fbp PE=3 SV=1
12	AFDB:G5EAZ6	0.955	0.912	5.237E-46	355	0.425	0.406	G5EAZ6.pdb.gz	G5EAZ6_EMENI fructose-bisphosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05604 PE=3 SV=1
13	AFDB:Q38EA4	0.946	0.916	5.555E-46	350	0.422	0.409	Q38EA4.pdb.gz	Q38EA4_TRYB2 fructose-bisphosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0540 PE=3 SV=1
14	AFDB:P25851	0.933	0.761	1.807E-45	417	0.428	0.348	P25851.pdb.gz	F16P1_ARATH Fructose-1,6-bisphosphatase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CFBP1 PE=1 SV=2
15	PDB:5oeyC	0.910	0.946	2.835E-43	326	0.404	0.420	5oeyC.pdb.gz	Structures of Leishmania Fructose-1,6-Bisphosphatase Reveal Species-Specific Differences in the Mechanism of Allosteric Inhibition.
16	PDB:2qvrA	0.921	0.940	2.818E-41	332	0.395	0.404	2qvrA.pdb.gz	Structures of Mammalian and Bacterial Fructose-1,6-bisphosphatase Reveal the Basis for Synergism in AMP/Fructose 2,6-Bisphosphate Inhibition.
17	PDB:7ns5A	0.877	0.930	5.718E-41	319	0.410	0.436	7ns5A.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
18	PDB:5oeyD	0.860	0.967	9.664E-39	301	0.383	0.432	5oeyD.pdb.gz	Structures of Leishmania Fructose-1,6-Bisphosphatase Reveal Species-Specific Differences in the Mechanism of Allosteric Inhibition.
19	PDB:2gq1A	0.855	0.933	1.294E-37	310	0.369	0.403	2gq1A.pdb.gz	Novel Allosteric Activation Site in Escherichia coli Fructose-1,6-bisphosphatase.
20	PDB:6ib8B	0.603	0.740	1.708E-11	270	0.142	0.178	6ib8B.pdb.gz	Structural basis for the function of SuhB as a transcription factor in ribosomal RNA synthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060XAF0	0.0	549	337	0.752	0.757	A0A060XAF0_ONCMY fructose-bisphosphatase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00063051001 PE=3 SV=1
2	A0A060Y8H0	0.0	548	337	0.749	0.754	A0A060Y8H0_ONCMY fructose-bisphosphatase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00015701001 PE=3 SV=1
3	O00757	0.0	693	339	1.000	1.000	F16P2_HUMAN Fructose-1,6-bisphosphatase isozyme 2 OS=Homo sapiens OX=9606 GN=FBP2 PE=1 SV=2
4	P00637	0.0	545	338	0.749	0.751	F16P1_RABIT Fructose-1,6-bisphosphatase 1 OS=Oryctolagus cuniculus OX=9986 GN=FBP1 PE=1 SV=4
5	P09467	0.0	521	338	0.764	0.766	F16P1_HUMAN Fructose-1,6-bisphosphatase 1 OS=Homo sapiens OX=9606 GN=FBP1 PE=1 SV=5
6	P19112	0.0	538	363	0.746	0.697	F16P1_RAT Fructose-1,6-bisphosphatase 1 OS=Rattus norvegicus OX=10116 GN=Fbp1 PE=1 SV=2
7	Q7T337	0.0	553	337	0.761	0.766	Q7T337_DANRE fructose-bisphosphatase OS=Danio rerio OX=7955 GN=cb598 PE=1 SV=1
8	Q9QXD6	0.0	538	338	0.740	0.743	F16P1_MOUSE Fructose-1,6-bisphosphatase 1 OS=Mus musculus OX=10090 GN=Fbp1 PE=1 SV=3
9	Q9Z1N1	0.0	667	339	0.947	0.947	F16P2_RAT Fructose-1,6-bisphosphatase isozyme 2 OS=Rattus norvegicus OX=10116 GN=Fbp2 PE=1 SV=1
10	Q9MA79	1.19e-126	368	341	0.534	0.531	F16P2_ARATH Fructose-1,6-bisphosphatase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=CYFBP PE=1 SV=1
11	Q6RYT0	5.55e-108	320	346	0.451	0.442	F16P_DICDI Fructose-1,6-bisphosphatase OS=Dictyostelium discoideum OX=44689 GN=fbp PE=3 SV=1
12	Q9I8D3	1.41e-103	303	166	0.428	0.873	Q9I8D3_CHICK fructose-bisphosphatase (Fragment) OS=Gallus gallus OX=9031 GN=FBP2 PE=2 SV=1
13	P09201	2.20e-100	301	348	0.445	0.434	F16P_YEAST Fructose-1,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FBP1 PE=1 SV=2
14	P25851	1.87e-94	288	417	0.434	0.353	F16P1_ARATH Fructose-1,6-bisphosphatase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CFBP1 PE=1 SV=2
15	A0A1D8PKW2	3.40e-92	280	331	0.454	0.465	A0A1D8PKW2_CANAL fructose-bisphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FBP1 PE=3 SV=1
16	Q9I8D4	9.22e-92	273	168	0.378	0.762	Q9I8D4_CHICK fructose-bisphosphatase (Fragment) OS=Gallus gallus OX=9031 GN=FBP1 PE=2 SV=1
17	G5EAZ6	3.88e-90	275	355	0.428	0.408	G5EAZ6_EMENI fructose-bisphosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05604 PE=3 SV=1
18	P09202	1.79e-89	273	347	0.410	0.401	F16P_SCHPO Fructose-1,6-bisphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fbp1 PE=3 SV=1
19	Q38EA4	2.78e-88	270	350	0.425	0.411	Q38EA4_TRYB2 fructose-bisphosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0540 PE=3 SV=1
20	Q95PL6	2.16e-87	268	350	0.422	0.409	Q95PL6_9TRYP fructose-bisphosphatase OS=Trypanosoma brucei OX=5691 GN=FBPase PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01061 ABC2_membrane	8.4e+02	10.8	ABC-2 type transporter
2	PF00316 FBPase	1.1e-72	255.3	Fructose-1-6-bisphosphatase, N-terminal domain
3	PF18913 FBPase_C	5.1e-49	176.8	Fructose-1-6-bisphosphatase, C-terminal domain
4	PF00459 Inositol_P	0.41	21.7	Inositol monophosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364486

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363988	0.971	Belongs to the class I fructose-bisphosphate aldolase family
2	9606.ENSP00000226253	0.965	Belongs to the class I fructose-bisphosphate aldolase family
3	9606.ENSP00000292432	0.964	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
4	9606.ENSP00000346643	0.964	Putative hexokinase HKDC1
5	9606.ENSP00000378669	0.962	Fructose-bisphosphate aldolase A
6	9606.ENSP00000321259	0.961	Transaldolase
7	9606.ENSP00000405573	0.960	Glucose-6-phosphate isomerase
8	9606.ENSP00000402103	0.951	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
9	9606.ENSP00000345771	0.950	ATP-dependent 6-phosphofructokinase, muscle type
10	9606.ENSP00000391481	0.949	Transketolase
11	9606.ENSP00000408025	0.949	Fructose-1,6-bisphosphatase 1
12	9606.ENSP00000269848	0.948	ATP-dependent 6-phosphofructokinase, liver type
13	9606.ENSP00000290573	0.948	Hexokinase-2
14	9606.ENSP00000370517	0.944	ATP-dependent 6-phosphofructokinase, platelet type
15	9606.ENSP00000318318	0.941	Mannose-6-phosphate isomerase
16	9606.ENSP00000280605	0.939	Transketolase-like protein 2
17	9606.ENSP00000358931	0.936	Transketolase-like protein 1
18	9606.ENSP00000407545	0.933	Zinc finger and BTB domain-containing protein 22
19	9606.ENSP00000356047	0.834	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
20	9606.ENSP00000443319	0.834	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042132	1.000	fructose 1,6-bisphosphate 1-phosphatase activity
GO:0005515	0.991	protein binding
GO:0042802	0.938	identical protein binding
GO:0043167	0.544	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:0005975	0.993	carbohydrate metabolic process
GO:0019318	0.965	hexose metabolic process
GO:0009987	0.668	cellular process
GO:0044237	0.664	cellular metabolic process
GO:1901576	0.646	organic substance biosynthetic process
GO:0006793	0.431	phosphorus metabolic process
GO:0016051	0.424	carbohydrate biosynthetic process
GO:0006796	0.375	phosphate-containing compound metabolic process
GO:0019637	0.374	organophosphate metabolic process
GO:0006006	0.345	glucose metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	1.000	cytosol
GO:0005615	0.983	extracellular space
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0016020	0.973	membrane
GO:0031982	0.960	vesicle
GO:0070062	0.945	extracellular exosome
GO:0005634	0.777	nucleus
GO:0070013	0.592	intracellular organelle lumen
GO:0005886	0.462	plasma membrane
GO:0012505	0.384	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11064	1.000	beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate
EC:3.1.3.11	1.000	fructose-bisphosphatase.

[back to server]