StarFunc result for job id O00764

User Input

>input (312 residues)
MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSD
ELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKW
DGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGP
DTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDI
EDPEIVVQATVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00764	1.000	1.000	1.761E-68	312	1.000	1.000	O00764.pdb.gz	PDXK_HUMAN Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK PE=1 SV=1
2	AFDB:O35331	0.997	0.997	1.425E-62	312	0.853	0.853	O35331.pdb.gz	PDXK_RAT Pyridoxal kinase OS=Rattus norvegicus OX=10116 GN=Pdxk PE=1 SV=1
3	PDB:2f7kA	0.979	0.946	6.566E-56	323	1.000	0.966	2f7kA.pdb.gz
4	AFDB:Q8W1X2	0.913	0.922	2.573E-40	309	0.468	0.472	Q8W1X2.pdb.gz	PDXK_ARATH Pyridoxal kinase OS=Arabidopsis thaliana OX=3702 GN=PK PE=1 SV=2
5	AFDB:Q7KUC2	0.904	0.928	2.454E-37	304	0.458	0.470	Q7KUC2.pdb.gz	Q7KUC2_DROME Pyridoxal kinase OS=Drosophila melanogaster OX=7227 GN=Pdxk PE=1 SV=1
6	AFDB:Q55EK9	0.909	0.938	9.453E-37	302	0.426	0.440	Q55EK9.pdb.gz	PDXK_DICDI Pyridoxal kinase OS=Dictyostelium discoideum OX=44689 GN=pykA PE=1 SV=1
7	AFDB:O14242	0.896	0.904	4.784E-31	309	0.369	0.372	O14242.pdb.gz	YELB_SCHPO Putative pyridoxal kinase C6F6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6F6.11c PE=3 SV=2
8	AFDB:D6XI07	0.878	0.912	5.073E-31	300	0.375	0.390	D6XI07.pdb.gz	D6XI07_TRYB2 pyridoxal kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.240 PE=3 SV=1
9	AFDB:O74860	0.887	0.817	4.441E-30	340	0.337	0.309	O74860.pdb.gz	YQ9A_SCHPO Putative pyridoxal kinase C18.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC18.10 PE=3 SV=1
10	AFDB:P39988	0.852	0.852	2.735E-29	312	0.343	0.343	P39988.pdb.gz	BUD16_YEAST Putative pyridoxal kinase BUD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD16 PE=1 SV=1
11	AFDB:P53727	0.864	0.851	9.222E-28	317	0.333	0.328	P53727.pdb.gz	BUD17_YEAST Putative pyridoxal kinase BUD17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD17 PE=1 SV=1
12	PDB:6su9A	0.812	0.856	1.342E-26	295	0.272	0.288	6su9A.pdb.gz	Crystal structure of Plasmodium falciparum PdxK with ligands AMP-PNP and PL.
13	PDB:1vi9A	0.846	0.914	3.580E-25	288	0.285	0.309	1vi9A.pdb.gz
14	PDB:2ddmB	0.705	0.804	3.023E-18	271	0.228	0.262	2ddmB.pdb.gz
15	PDB:3rm5A	0.637	0.400	5.736E-14	521	0.138	0.083	3rm5A.pdb.gz
16	PDB:1gqtB	0.506	0.513	3.572E-10	307	0.160	0.163	1gqtB.pdb.gz	Activation of Ribokinase by Monovalent Cations.
17	PDB:7vtdA	0.504	0.511	1.298E-9	307	0.154	0.156	7vtdA.pdb.gz
18	PDB:7ag6A	0.482	0.495	7.418E-8	302	0.157	0.162	7ag6A.pdb.gz	Molecular Basis of Sulfosugar Selectivity in Sulfoglycolysis.
19	PDB:3in1A	0.495	0.495	9.379E-8	312	0.138	0.138	3in1A.pdb.gz	Crystal structure of a putative Ribokinase in complex with ADP from E.coli
20	PDB:5bycA	0.496	0.487	1.499E-7	318	0.160	0.157	5bycA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F2Z2Y4	0.0	550	272	0.853	0.978	F2Z2Y4_HUMAN Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK PE=1 SV=1
2	O00764	0.0	649	312	1.000	1.000	PDXK_HUMAN Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK PE=1 SV=1
3	O35331	0.0	567	312	0.853	0.853	PDXK_RAT Pyridoxal kinase OS=Rattus norvegicus OX=10116 GN=Pdxk PE=1 SV=1
4	V9HWC3	0.0	649	312	1.000	1.000	V9HWC3_HUMAN Pyridoxal kinase OS=Homo sapiens OX=9606 GN=HEL-S-1a PE=2 SV=1
5	Q8W1X2	1.19e-97	292	309	0.465	0.469	PDXK_ARATH Pyridoxal kinase OS=Arabidopsis thaliana OX=3702 GN=PK PE=1 SV=2
6	Q7KUC2	1.16e-85	261	304	0.458	0.470	Q7KUC2_DROME Pyridoxal kinase OS=Drosophila melanogaster OX=7227 GN=Pdxk PE=1 SV=1
7	Q55EK9	4.37e-72	226	302	0.420	0.434	PDXK_DICDI Pyridoxal kinase OS=Dictyostelium discoideum OX=44689 GN=pykA PE=1 SV=1
8	D6XI07	4.23e-61	198	300	0.381	0.397	D6XI07_TRYB2 pyridoxal kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.240 PE=3 SV=1
9	O14242	5.54e-61	198	309	0.369	0.372	YELB_SCHPO Putative pyridoxal kinase C6F6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6F6.11c PE=3 SV=2
10	P39988	3.14e-56	186	312	0.359	0.359	BUD16_YEAST Putative pyridoxal kinase BUD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD16 PE=1 SV=1
11	O74860	4.04e-45	158	340	0.333	0.306	YQ9A_SCHPO Putative pyridoxal kinase C18.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC18.10 PE=3 SV=1
12	P53727	5.95e-45	157	317	0.301	0.297	BUD17_YEAST Putative pyridoxal kinase BUD17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD17 PE=1 SV=1
13	P77150	7.98e-31	119	287	0.205	0.223	PDXY_ECOLI Pyridoxal kinase PdxY OS=Escherichia coli (strain K12) OX=83333 GN=pdxY PE=1 SV=3
14	P40191	5.32e-20	90.1	283	0.212	0.233	PDXK_ECOLI Pyridoxine/pyridoxal/pyridoxamine kinase OS=Escherichia coli (strain K12) OX=83333 GN=pdxK PE=1 SV=2
15	C6KT01	8.26e-18	85.9	497	0.170	0.107	C6KT01_PLAF7 pyridoxal kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0616000 PE=1 SV=1
16	O48881	6.27e-09	58.9	523	0.112	0.067	TPS1_BRANA Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic OS=Brassica napus OX=3708 GN=BTH1 PE=1 SV=1
17	O51709	7.56e-09	57.8	264	0.215	0.254	O51709_BORBU pyridoxal kinase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0768 PE=4 SV=1
18	Q5M731	2.51e-08	57.4	522	0.122	0.073	TPS1L_ARATH Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TH1 PE=1 SV=1
19	P0A9J6	1.03e-04	45.4	309	0.122	0.123	RBSK_ECOLI Ribokinase OS=Escherichia coli (strain K12) OX=83333 GN=rbsK PE=1 SV=1
20	E9AD19	0.005	40.4	329	0.106	0.100	RBSK_LEIMA Ribokinase OS=Leishmania major OX=5664 GN=LMJF_27_0420 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08955 BofC_C	6.1e+02	11.9	BofC C-terminal domain
2	PF03328 HpcH_HpaI	62	14.3	HpcH/HpaI aldolase/citrate lyase family
3	PF00294 PfkB	2.1e-05	35.6	pfkB family carbohydrate kinase
4	PF08543 Phos_pyr_kin	7.3e-13	60.0	Phosphomethylpyrimidine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225573	0.991	Pyridoxine-5'-phosphate oxidase
2	9606.ENSP00000363832	0.923	Aldehyde oxidase
3	9606.ENSP00000215904	0.919	Pyridoxal phosphate phosphatase
4	9606.ENSP00000481046	0.804	Pyridoxal phosphate phosphatase PHOSPHO2
5	9606.ENSP00000266304	0.769	Thyrotroph embryonic factor
6	9606.ENSP00000222122	0.723	D site-binding protein
7	9606.ENSP00000273398	0.714	V-type proton ATPase catalytic subunit A
8	9606.ENSP00000265395	0.706	3-hydroxyisobutyrate dehydrogenase, mitochondrial
9	9606.ENSP00000339145	0.702	Ribosomal RNA processing protein 1 homolog B
10	9606.ENSP00000307143	0.678	Protein downstream neighbor of Son
11	9606.ENSP00000353165	0.665	Thiamin pyrophosphokinase 1
12	9606.ENSP00000303584	0.652	HemK methyltransferase family member 2
13	9606.ENSP00000234677	0.651	Serine--tRNA ligase, cytoplasmic
14	9606.ENSP00000339613	0.650	GDP-fucose protein O-fucosyltransferase 2
15	9606.ENSP00000345528	0.643	Solute carrier family 35 member F6
16	9606.ENSP00000333551	0.637	Pyridoxal phosphate homeostasis protein
17	9606.ENSP00000308759	0.621	Zinc finger and BTB domain-containing protein 21
18	9606.ENSP00000368458	0.618	Proliferating cell nuclear antigen
19	9606.ENSP00000407726	0.603	Von Willebrand factor A domain-containing protein 5A
20	9606.ENSP00000367992	0.599	S-formylglutathione hydrolase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043169	0.995	cation binding
GO:0070279	0.995	vitamin B6 binding
GO:0008478	0.995	pyridoxal kinase activity
GO:0005515	0.968	protein binding
GO:0046872	0.907	metal ion binding
GO:0042802	0.862	identical protein binding
GO:0043168	0.827	anion binding
GO:0032555	0.826	purine ribonucleotide binding
GO:0031420	0.825	alkali metal ion binding
GO:0032559	0.796	adenyl ribonucleotide binding
GO:0030955	0.792	potassium ion binding
GO:0000287	0.725	magnesium ion binding
GO:0030170	0.577	pyridoxal phosphate binding
GO:0005524	0.471	ATP binding
GO:0031402	0.390	sodium ion binding
GO:0046983	0.369	protein dimerization activity
GO:0042803	0.358	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901360	0.996	organic cyclic compound metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0046483	0.996	heterocycle metabolic process
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:0042816	0.987	vitamin B6 metabolic process
GO:0044271	0.978	cellular nitrogen compound biosynthetic process
GO:1901617	0.955	organic hydroxy compound biosynthetic process
GO:0018130	0.952	heterocycle biosynthetic process
GO:0042364	0.951	water-soluble vitamin biosynthetic process
GO:1901566	0.942	organonitrogen compound biosynthetic process
GO:1901362	0.928	organic cyclic compound biosynthetic process
GO:0006793	0.926	phosphorus metabolic process
GO:0006081	0.926	cellular aldehyde metabolic process
GO:0019637	0.924	organophosphate metabolic process
GO:0006725	0.918	cellular aromatic compound metabolic process
GO:0072525	0.910	pyridine-containing compound biosynthetic process
GO:0090407	0.902	organophosphate biosynthetic process
GO:0006796	0.897	phosphate-containing compound metabolic process
GO:0019438	0.835	aromatic compound biosynthetic process
GO:0065007	0.535	biological regulation
GO:0050789	0.493	regulation of biological process
GO:0046184	0.462	aldehyde biosynthetic process
GO:0050896	0.450	response to stimulus
GO:0050794	0.413	regulation of cellular process
GO:0043094	0.327	cellular metabolic compound salvage
GO:0044238	0.314	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.997	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0005737	0.884	cytoplasm
GO:0005829	0.826	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10224	0.995	ATP + pyridoxal = ADP + H(+) + pyridoxal 5'-phosphate
EC:2.7.1.35	0.995	pyridoxal kinase.

[back to server]