StarFunc result for job id O14490

User Input

>input (977 residues)
MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGP
FSDPLASSTFPRRHYTSQQELKDECALVPRTLATKANRIPANLLDQFERQLPLSRDGYHT
LQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSVNGGKASPDEAQAARYGK
RSKSKERRAEPKARPSTSPGWWSSDDNLDGDMCIYHAPSGVMTMGRCPDRSASQYFLEAY
NTISEQAVKASRSNNDVKCSTCANLPVSLDTPLLKKSAWSSTLTVSRAREVYQKASVNMD
QAMVKSESCQQERSCQYLQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSD
TSPKPSPKVAARRESYLKATQPSLTELTTLKISNEHSPKLQIRSHSYLRAVSEVSINRSL
DSLDPAGLLTSPKFRSRNESYMRAMSTISQVSEMEVNGQFESVCESVFSELESQAVEALD
LPMPGCFRMRSHSYVRAIEKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTVSSCITTYKK
TPPPVPPRTTTKPFISITAQSSTESAQDAYMDGQGQRGDIISQSGLSNSTESLDSMKALT
AAIEAANAQIHGPASQHMGNNTATVTTTTTIATVTTEDRKKDHFKKNRCLSIGIQVDDAE
EPDKTGENKAPSKFQSVGVQVEEEKCFRRFTRSNSVTTAVQADLDFHDNLENSLESIEDN
SCPGPMARQFSRDASTSTVSIQGSGNHYHACAADDDFDTDFDPSILPPPDPWIDSITEDP
LEAVQRSVCHRDGHWFLKLLQAERDRMEGWCQQMEREERENNLPEDILGKIRTAVGSAQL
LMAQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWK
QMDPLDKKERRAPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAASVRQNSAT
ESAESIEIYIPEAQTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97836	0.483	0.478	0.000	992	0.959	0.945	P97836.pdb.gz	DLGP1_RAT Disks large-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dlgap1 PE=1 SV=1
2	AFDB:P97837	0.234	0.219	2.057E-59	1059	0.537	0.496	P97837.pdb.gz	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
3	AFDB:B1AZP2	0.220	0.217	8.500E-53	992	0.477	0.470	B1AZP2.pdb.gz	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
4	PDB:4r0yB	0.112	0.229	6.648E-15	473	0.112	0.230	4r0yB.pdb.gz
5	AFDB:O60293	0.057	0.032	2.312E-4	1989	0.133	0.065	O60293.pdb.gz	ZC3H1_HUMAN Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3
6	AFDB:M9PB92	0.047	0.044	8.308E-4	1062	0.110	0.101	M9PB92.pdb.gz	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
7	AFDB:P39769	0.046	0.035	1.875E-3	1589	0.140	0.086	P39769.pdb.gz	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
8	AFDB:Q9HC77	0.069	0.056	2.232E-3	1338	0.150	0.110	Q9HC77.pdb.gz	CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2
9	AFDB:Q5T1N1	0.038	0.043	1.435E-2	836	0.103	0.121	Q5T1N1.pdb.gz	AKND1_HUMAN Protein AKNAD1 OS=Homo sapiens OX=9606 GN=AKNAD1 PE=1 SV=3
10	AFDB:Q6DRG7	0.041	0.047	1.435E-2	1049	0.113	0.105	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
11	AFDB:Q9TZK8	0.050	0.056	1.521E-2	832	0.099	0.117	Q9TZK8.pdb.gz	Q9TZK8_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=meg-4 PE=1 SV=1
12	PDB:5imjA	0.062	0.143	4.857E-1	246	0.018	0.073	5imjA.pdb.gz
13	PDB:1y8pA	0.072	0.150	1.554	381	0.023	0.058	1y8pA.pdb.gz	Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
14	PDB:6o6pA	0.049	0.178	1.554	188	0.011	0.059	6o6pA.pdb.gz	Mycobacterium tuberculosis FasR senses long fatty acyl-CoA through a tunnel and a hydrophobic transmission spine.
15	PDB:6elzb	0.087	0.178	1.647	421	0.012	0.029	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
16	PDB:7nsuD	0.065	0.134	1.850	420	0.014	0.033	7nsuD.pdb.gz
17	PDB:6v69I	0.085	0.138	1.961	543	0.021	0.039	6v69I.pdb.gz
18	PDB:5mx5L	0.090	0.313	2.203	214	0.018	0.084	5mx5L.pdb.gz
19	PDB:7cx2R	0.068	0.176	2.203	266	0.012	0.045	7cx2R.pdb.gz	Ligand recognition, unconventional activation, and G protein coupling of the prostaglandin E 2 receptor EP2 subtype.
20	PDB:1rj1A	0.059	0.305	2.334	148	0.013	0.088	1rj1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AZP2	0.0	704	992	0.493	0.486	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
2	O14490	0.0	2038	977	1.000	1.000	DLGP1_HUMAN Disks large-associated protein 1 OS=Homo sapiens OX=9606 GN=DLGAP1 PE=1 SV=1
3	O95886	0.0	574	979	0.418	0.417	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
4	P97836	0.0	1786	992	0.955	0.941	DLGP1_RAT Disks large-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dlgap1 PE=1 SV=1
5	P97837	0.0	820	1059	0.545	0.502	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
6	P97838	0.0	555	977	0.403	0.403	DLGP3_RAT Disks large-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Dlgap3 PE=1 SV=2
7	P97839	0.0	694	992	0.484	0.477	DLGP4_RAT Disks large-associated protein 4 OS=Rattus norvegicus OX=10116 GN=Dlgap4 PE=1 SV=1
8	Q6IS01	0.0	1102	543	0.544	0.978	Q6IS01_HUMAN DLG associated protein 1 OS=Homo sapiens OX=9606 GN=DLGAP1 PE=1 SV=1
9	Q6PFD5	0.0	571	977	0.412	0.412	DLGP3_MOUSE Disks large-associated protein 3 OS=Mus musculus OX=10090 GN=Dlgap3 PE=1 SV=1
10	Q8BJ42	0.0	827	1059	0.551	0.508	DLGP2_MOUSE Disks large-associated protein 2 OS=Mus musculus OX=10090 GN=Dlgap2 PE=1 SV=2
11	Q9D415	0.0	1790	992	0.955	0.941	DLGP1_MOUSE Disks large-associated protein 1 OS=Mus musculus OX=10090 GN=Dlgap1 PE=1 SV=3
12	Q9P1A6	0.0	849	1054	0.561	0.520	DLGP2_HUMAN Disks large-associated protein 2 OS=Homo sapiens OX=9606 GN=DLGAP2 PE=1 SV=4
13	Q9Y2H0	0.0	731	992	0.507	0.499	DLGP4_HUMAN Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4 PE=1 SV=3
14	Q15398	1.31e-13	77.8	846	0.056	0.065	DLGP5_HUMAN Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5 PE=1 SV=2
15	Q7K3L1	7.46e-10	65.5	921	0.049	0.052	MARS_DROME Guanylate kinase-associated protein mars OS=Drosophila melanogaster OX=7227 GN=mars PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03359 GKAP	2.9e-158	538.5	Guanylate-kinase-associated protein (GKAP) protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008422

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009746	0.996	Discs, large homolog 4 (Drosophila)
2	61853.ENSNLEP00000002540	0.965	Discs, large homolog 1 (Drosophila)
3	61853.ENSNLEP00000006942	0.957	SH3 and multiple ankyrin repeat domains 1
4	61853.ENSNLEP00000021326	0.917	Cyclin-dependent kinase 2
5	61853.ENSNLEP00000012911	0.911	SH3 and multiple ankyrin repeat domains 2
6	61853.ENSNLEP00000001419	0.907	annotation not available
7	61853.ENSNLEP00000019977	0.885	Discs, large homolog 2 (Drosophila)
8	61853.ENSNLEP00000001169	0.842	Discs, large homolog 3 (Drosophila)
9	61853.ENSNLEP00000012325	0.783	Glutamate receptor, ionotropic, N-methyl D-aspartate 2A
10	61853.ENSNLEP00000011061	0.773	Glutamate receptor, ionotropic, N-methyl D-aspartate 1
11	61853.ENSNLEP00000002367	0.768	Belongs to the protein kinase superfamily.
12	61853.ENSNLEP00000004561	0.755	Glutamate receptor, ionotropic, N-methyl D-aspartate 2B
13	61853.ENSNLEP00000015629	0.726	Homer homolog 1 (Drosophila)
14	61853.ENSNLEP00000017317	0.669	Guanylate kinase 1
15	61853.ENSNLEP00000019514	0.659	Glutamate receptor, metabotropic 5
16	61853.ENSNLEP00000018492	0.657	Glutamate receptor, metabotropic 1
17	61853.ENSNLEP00000001203	0.653	Tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1
18	61853.ENSNLEP00000006798	0.644	Uncharacterized protein
19	61853.ENSNLEP00000020916	0.623	ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
20	61853.ENSNLEP00000000724	0.622	Mitogen-activated protein kinase 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019904	0.740	protein domain specific binding
GO:0098919	0.570	structural constituent of postsynaptic density
GO:0044877	0.402	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0099536	0.987	synaptic signaling
GO:0007268	0.968	chemical synaptic transmission
GO:0065007	0.854	biological regulation
GO:0050789	0.837	regulation of biological process
GO:0050794	0.820	regulation of cellular process
GO:0051179	0.390	localization
GO:0050896	0.386	response to stimulus
GO:0071840	0.384	cellular component organization or biogenesis
GO:0016043	0.367	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005886	0.999	plasma membrane
GO:0045202	0.988	synapse
GO:0005622	0.982	intracellular anatomical structure
GO:0043229	0.957	intracellular organelle
GO:0098794	0.937	postsynapse
GO:0043232	0.935	intracellular non-membrane-bounded organelle
GO:0099572	0.931	postsynaptic specialization
GO:0098984	0.898	neuron to neuron synapse
GO:0032279	0.879	asymmetric synapse
GO:0014069	0.839	postsynaptic density
GO:0005737	0.791	cytoplasm
GO:0043231	0.676	intracellular membrane-bounded organelle
GO:0070013	0.413	intracellular organelle lumen
GO:0098590	0.402	plasma membrane region
GO:0098978	0.394	glutamatergic synapse
GO:0097060	0.363	synaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]