StarFunc result for job id O14492

User Input

>input (632 residues)
MNGAGPGPAAAAPVPVPVPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDAGAS
FSRHFAANFLDVFGEEVRRVLVAGPTTRGAAVSAEAMEPELADTSALKAAPYGHSRSSED
VSTHAATKARVRKGFSLRNMSLCVVDGVRDMWHRRASPEPDAAAAPRTAEPRDKWTRRLR
LSRTLAAKVELVDIQREGALRFMVADDAAAGSGGSAQWQKCRLLLRRAVAEERFRLEFFV
PPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVAD
IQGCVDPGDSEEDTELSCTRGGCLASRVASCSCELLTDAVDLPRPPETTAVGAVVTAPHS
RGRDAVRESLIHVPLETFLQTLESPGGSGSDSNNTGEQGAETDPEAEPELELSDYPWFHG
TLSRVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQ
HLWFQSVLDMLRHFHTHPIPLESGGSADITLRSYVRAQDPPPEPGPTPPAAPASPACWSD
SPGQHYFSSLAAAACPPASPSDAAGASSSSASSSSAASGPAPPRPVEGQLSARSRSNSAE
RLLEAVAATAAEEPPEAAPGRARAVENQYSFY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14492	1.000	1.000	7.726E-100	632	1.000	1.000	O14492.pdb.gz	SH2B2_HUMAN SH2B adapter protein 2 OS=Homo sapiens OX=9606 GN=SH2B2 PE=1 SV=2
2	AFDB:Q9UQQ2	0.182	0.199	1.418E-33	575	0.348	0.383	Q9UQQ2.pdb.gz	SH2B3_HUMAN SH2B adapter protein 3 OS=Homo sapiens OX=9606 GN=SH2B3 PE=1 SV=2
3	AFDB:P50745	0.171	0.290	2.196E-15	368	0.169	0.291	P50745.pdb.gz	SH2B3_RAT SH2B adapter protein 3 OS=Rattus norvegicus OX=10116 GN=Sh2b3 PE=1 SV=1
4	AFDB:A4QPE4	0.150	0.105	6.153E-9	934	0.119	0.080	A4QPE4.pdb.gz	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
5	PDB:4fl2A	0.142	0.160	1.861E-6	555	0.043	0.049	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
6	PDB:1ka6A	0.143	0.762	2.084E-6	107	0.040	0.234	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
7	PDB:1griA	0.148	0.414	5.142E-6	211	0.043	0.128	1griA.pdb.gz
8	AFDB:F1Q7S5	0.158	0.136	1.664E-5	740	0.120	0.103	F1Q7S5.pdb.gz	F1Q7S5_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=1
9	PDB:1k9aB	0.124	0.174	3.130E-5	441	0.040	0.057	1k9aB.pdb.gz
10	PDB:3ps5A	0.135	0.160	3.130E-5	529	0.052	0.062	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
11	AFDB:Q9UQC2	0.158	0.148	5.445E-5	676	0.119	0.111	Q9UQC2.pdb.gz	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1
12	AFDB:F6NTT0	0.157	0.143	6.096E-5	712	0.112	0.100	F6NTT0.pdb.gz	F6NTT0_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=2
13	AFDB:P34288	0.146	0.062	6.096E-5	1605	0.123	0.049	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
14	PDB:6u3eA	0.133	0.207	6.162E-5	397	0.036	0.058	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:4mk0A	0.147	0.147	7.723E-5	631	0.035	0.035	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:5xzrA	0.141	0.171	7.723E-5	519	0.044	0.054	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
17	PDB:4k2rA	0.135	0.154	8.172E-5	551	0.028	0.033	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
18	PDB:3cxlA	0.110	0.169	9.149E-5	402	0.047	0.075	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
19	AFDB:D3ZAL7	0.164	0.150	1.885E-4	693	0.093	0.085	D3ZAL7.pdb.gz	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3
20	AFDB:P49796	0.135	0.076	1.994E-4	1198	0.131	0.069	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14492	0.0	1281	632	1.000	1.000	SH2B2_HUMAN SH2B adapter protein 2 OS=Homo sapiens OX=9606 GN=SH2B2 PE=1 SV=2
2	Q9JID9	0.0	970	621	0.820	0.834	SH2B2_MOUSE SH2B adapter protein 2 OS=Mus musculus OX=10090 GN=Sh2b2 PE=1 SV=2
3	Q9Z200	0.0	993	621	0.837	0.852	SH2B2_RAT SH2B adapter protein 2 OS=Rattus norvegicus OX=10116 GN=Sh2b2 PE=1 SV=1
4	C9JK89	1.27e-172	492	243	0.384	1.000	C9JK89_HUMAN SH2B adapter protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SH2B2 PE=1 SV=3
5	Q62985	8.43e-97	315	756	0.383	0.320	SH2B1_RAT SH2B adapter protein 1 OS=Rattus norvegicus OX=10116 GN=Sh2b1 PE=1 SV=1
6	Q91ZM2	4.11e-96	313	756	0.381	0.319	SH2B1_MOUSE SH2B adapter protein 1 OS=Mus musculus OX=10090 GN=Sh2b1 PE=1 SV=2
7	Q9UQQ2	1.65e-69	238	575	0.301	0.330	SH2B3_HUMAN SH2B adapter protein 3 OS=Homo sapiens OX=9606 GN=SH2B3 PE=1 SV=2
8	A0A0B4LHS0	1.71e-63	223	613	0.255	0.263	A0A0B4LHS0_DROME Lnk, isoform E OS=Drosophila melanogaster OX=7227 GN=Lnk PE=3 SV=1
9	A0A0B4LHY5	1.32e-62	222	728	0.255	0.221	A0A0B4LHY5_DROME Lnk, isoform D OS=Drosophila melanogaster OX=7227 GN=Lnk PE=3 SV=1
10	Q9NRF2	5.39e-49	184	756	0.210	0.176	SH2B1_HUMAN SH2B adapter protein 1 OS=Homo sapiens OX=9606 GN=SH2B1 PE=1 SV=3
11	Q9U8B9	9.90e-42	155	319	0.119	0.235	Q9U8B9_DROME Lnk-like protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=Lnk PE=2 SV=2
12	A0A0B4LIP5	1.92e-40	158	608	0.119	0.123	A0A0B4LIP5_DROME Lnk, isoform F OS=Drosophila melanogaster OX=7227 GN=Lnk PE=3 SV=1
13	Q7K137	7.81e-40	157	723	0.119	0.104	Q7K137_DROME LD10453p OS=Drosophila melanogaster OX=7227 GN=Lnk PE=2 SV=1
14	O09039	9.09e-40	155	548	0.158	0.182	SH2B3_MOUSE SH2B adapter protein 3 OS=Mus musculus OX=10090 GN=Sh2b3 PE=1 SV=2
15	P50745	4.97e-38	146	368	0.114	0.196	SH2B3_RAT SH2B adapter protein 3 OS=Rattus norvegicus OX=10116 GN=Sh2b3 PE=1 SV=1
16	P41241	3.35e-09	62.0	450	0.043	0.060	CSK_MOUSE Tyrosine-protein kinase CSK OS=Mus musculus OX=10090 GN=Csk PE=1 SV=2
17	P32577	3.59e-09	61.6	450	0.043	0.060	CSK_RAT Tyrosine-protein kinase CSK OS=Rattus norvegicus OX=10116 GN=Csk PE=1 SV=1
18	Q8INJ8	6.06e-09	61.6	1052	0.044	0.027	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
19	E7F3T0	7.06e-09	60.8	454	0.063	0.088	E7F3T0_DANRE SHC (Src homology 2 domain-containing)-transforming protein 1 OS=Danio rerio OX=7955 GN=shc1 PE=4 SV=2
20	E9QCZ8	7.22e-09	60.8	449	0.063	0.089	E9QCZ8_DANRE SHC (Src homology 2 domain-containing)-transforming protein 1 OS=Danio rerio OX=7955 GN=shc1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	4.9e-08	44.8	PH domain
2	PF08916 Phe_ZIP	8.9e-16	69.6	Phenylalanine zipper
3	PF00017 SH2	3.2e-09	48.1	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440273

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303830	0.997	Insulin receptor
2	9606.ENSP00000264033	0.992	E3 ubiquitin-protein ligase CBL
3	9606.ENSP00000360293	0.974	Sorbin and SH3 domain-containing protein 1
4	9606.ENSP00000304895	0.964	Insulin receptor substrate 1
5	9606.ENSP00000371067	0.954	Tyrosine-protein kinase JAK2
6	9606.ENSP00000288135	0.927	Mast/stem cell growth factor receptor Kit
7	9606.ENSP00000238738	0.923	Rho-related GTP-binding protein RhoQ
8	9606.ENSP00000380432	0.922	Insulin
9	9606.ENSP00000300574	0.912	Adapter molecule crk
10	9606.ENSP00000361263	0.908	Rap guanine nucleotide exchange factor 1
11	9606.ENSP00000376345	0.905	Growth factor receptor-bound protein 2
12	9606.ENSP00000228280	0.904	Kit ligand
13	9606.ENSP00000431418	0.884	High affinity nerve growth factor receptor
14	9606.ENSP00000277120	0.864	BDNF/NT-3 growth factors receptor
15	9606.ENSP00000264122	0.820	E3 ubiquitin-protein ligase CBL-B
16	9606.ENSP00000354207	0.820	NT-3 growth factor receptor
17	9606.ENSP00000387784	0.768	Son of sevenless homolog 1
18	9606.ENSP00000362680	0.736	Proto-oncogene tyrosine-protein kinase Src
19	9606.ENSP00000323714	0.734	Eukaryotic translation initiation factor 4E type 1B
20	9606.ENSP00000428924	0.733	Tyrosine-protein kinase Lyn

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035591	1.000	signaling adaptor activity
GO:0019904	0.978	protein domain specific binding
GO:0042169	0.934	SH2 domain binding
GO:0005102	0.686	signaling receptor binding
GO:0019899	0.679	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0009987	0.993	cellular process
GO:0023052	0.985	signaling
GO:0007165	0.978	signal transduction
GO:0048518	0.972	positive regulation of biological process
GO:0007166	0.951	cell surface receptor signaling pathway
GO:0048583	0.945	regulation of response to stimulus
GO:0048584	0.887	positive regulation of response to stimulus
GO:0002768	0.845	immune response-regulating cell surface receptor signaling pathway
GO:0002376	0.824	immune system process
GO:0002684	0.765	positive regulation of immune system process
GO:0050851	0.756	antigen receptor-mediated signaling pathway
GO:0032501	0.681	multicellular organismal process
GO:0050853	0.665	B cell receptor signaling pathway
GO:0048522	0.648	positive regulation of cellular process
GO:0032502	0.589	developmental process
GO:0019222	0.461	regulation of metabolic process
GO:0048856	0.452	anatomical structure development
GO:0007169	0.436	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0023051	0.424	regulation of signaling
GO:0010646	0.424	regulation of cell communication
GO:0009966	0.411	regulation of signal transduction
GO:1902531	0.387	regulation of intracellular signal transduction
GO:0042221	0.365	response to chemical
GO:0010033	0.344	response to organic substance
GO:0070887	0.332	cellular response to chemical stimulus
GO:0071310	0.322	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0071944	0.998	cell periphery
GO:0016020	0.998	membrane
GO:0005886	0.992	plasma membrane
GO:0043226	0.977	organelle
GO:0043229	0.966	intracellular organelle
GO:0043227	0.803	membrane-bounded organelle
GO:0043231	0.780	intracellular membrane-bounded organelle
GO:0043232	0.622	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]