StarFunc result for job id O14495

User Input

>input (311 residues)
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK
PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN
PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR
CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY
TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD
IIDRNNHHNMM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97544	0.960	0.957	2.842E-46	312	0.942	0.939	P97544.pdb.gz	PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus OX=10116 GN=Plpp3 PE=1 SV=1
2	AFDB:O88956	0.781	0.852	4.354E-28	285	0.460	0.502	O88956.pdb.gz	PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus OX=10141 GN=PLPP1 PE=1 SV=1
3	AFDB:O08564	0.777	0.856	8.771E-28	282	0.450	0.496	O08564.pdb.gz	PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Plpp1 PE=1 SV=1
4	AFDB:Q61469	0.775	0.851	1.019E-27	283	0.441	0.484	Q61469.pdb.gz	PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus OX=10090 GN=Plpp1 PE=1 SV=1
5	AFDB:O43688	0.773	0.833	2.768E-26	288	0.418	0.451	O43688.pdb.gz	PLPP2_HUMAN Phospholipid phosphatase 2 OS=Homo sapiens OX=9606 GN=PLPP2 PE=1 SV=1
6	AFDB:Q9V576	0.741	0.613	1.119E-22	379	0.412	0.338	Q9V576.pdb.gz	WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=wun PE=1 SV=2
7	AFDB:Q7YU44	0.754	0.691	1.361E-19	340	0.305	0.279	Q7YU44.pdb.gz	Q7YU44_DROME RE35738p OS=Drosophila melanogaster OX=7227 GN=CG11426 PE=2 SV=1
8	AFDB:Q7KGH1	0.698	0.624	1.746E-18	350	0.315	0.280	Q7KGH1.pdb.gz	Q7KGH1_DROME FI04477p OS=Drosophila melanogaster OX=7227 GN=wun2 PE=2 SV=1
9	AFDB:A0A024R154	0.758	0.727	8.233E-18	325	0.296	0.283	A0A024R154.pdb.gz
10	AFDB:Q96GM1	0.705	0.643	2.876E-17	343	0.254	0.230	Q96GM1.pdb.gz	PLPR2_HUMAN Phospholipid phosphatase-related protein type 2 OS=Homo sapiens OX=9606 GN=PLPPR2 PE=1 SV=1
11	PDB:5jwyA	0.279	0.327	8.286E-2	259	0.119	0.143	5jwyA.pdb.gz	Structural Insight into Substrate Selection and Catalysis of Lipid Phosphate Phosphatase PgpB in the Cell Membrane.
12	PDB:2b6pA	0.155	0.173	2.369E-1	261	0.109	0.130	2b6pA.pdb.gz
13	PDB:6xboA	0.113	0.111	2.753E-1	319	0.100	0.097	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.
14	PDB:5dyeD	0.171	0.200	3.535E-1	253	0.113	0.138	5dyeD.pdb.gz	Plasma Membrane Abundance of Human Aquaporin 5 Is Dynamically Regulated by Multiple Pathways.
15	PDB:4povA	0.139	0.212	4.540E-1	178	0.103	0.180	4povA.pdb.gz	Structure-Based Design of Potent Small-Molecule Binders to the S-Component of the ECF Transporter for Thiamine.
16	PDB:6v3fA	0.144	0.049	5.545E-1	1234	0.093	0.024	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
17	PDB:7y12R	0.147	0.166	6.443E-1	264	0.100	0.117	7y12R.pdb.gz	Structural insight into the activation mechanism of MrgD with heterotrimeric Gi-protein revealed by cryo-EM.
18	PDB:8b8mB	0.144	0.080	6.443E-1	682	0.141	0.065	8b8mB.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
19	PDB:7vqxR	0.141	0.128	7.487E-1	361	0.077	0.066	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
20	PDB:7xw5R	0.125	0.082	7.871E-1	572	0.077	0.042	7xw5R.pdb.gz	Hormone- and antibody-mediated activation of the thyrotropin receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14495	0.0	647	311	1.000	1.000	PLPP3_HUMAN Phospholipid phosphatase 3 OS=Homo sapiens OX=9606 GN=PLPP3 PE=1 SV=1
2	P97544	0.0	612	312	0.945	0.942	PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus OX=10116 GN=Plpp3 PE=1 SV=1
3	Q99JY8	0.0	615	312	0.949	0.946	PLPP3_MOUSE Phospholipid phosphatase 3 OS=Mus musculus OX=10090 GN=Plpp3 PE=1 SV=1
4	P60588	6.67e-96	286	285	0.460	0.502	PLPP1_PIG Phospholipid phosphatase 1 OS=Sus scrofa OX=9823 GN=PLPP1 PE=1 SV=2
5	O08564	7.11e-96	286	282	0.450	0.496	PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Plpp1 PE=1 SV=1
6	O88956	1.31e-93	281	285	0.450	0.491	PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus OX=10141 GN=PLPP1 PE=1 SV=1
7	Q61469	2.56e-91	275	283	0.434	0.477	PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus OX=10090 GN=Plpp1 PE=1 SV=1
8	O14494	5.48e-91	274	284	0.463	0.507	PLPP1_HUMAN Phospholipid phosphatase 1 OS=Homo sapiens OX=9606 GN=PLPP1 PE=1 SV=1
9	Q8K593	2.15e-83	254	276	0.418	0.471	PLPP2_RAT Phospholipid phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Plpp2 PE=2 SV=1
10	O43688	6.08e-79	243	288	0.415	0.448	PLPP2_HUMAN Phospholipid phosphatase 2 OS=Homo sapiens OX=9606 GN=PLPP2 PE=1 SV=1
11	Q9V576	3.08e-63	206	379	0.399	0.327	WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=wun PE=1 SV=2
12	Q9VNT9	5.88e-46	160	340	0.293	0.268	Q9VNT9_DROME FI20175p1 OS=Drosophila melanogaster OX=7227 GN=WUN-like PE=2 SV=1
13	Q7YU44	5.94e-46	160	340	0.293	0.268	Q7YU44_DROME RE35738p OS=Drosophila melanogaster OX=7227 GN=CG11426 PE=2 SV=1
14	K7EMK9	5.12e-44	150	178	0.260	0.455	K7EMK9_HUMAN Phospholipid phosphatase 2 (Fragment) OS=Homo sapiens OX=9606 GN=PLPP2 PE=1 SV=2
15	Q9NGZ2	6.55e-39	142	350	0.322	0.286	Q9NGZ2_DROME Tunen OS=Drosophila melanogaster OX=7227 GN=wun2 PE=2 SV=1
16	Q8IGU7	9.35e-39	141	350	0.322	0.286	Q8IGU7_DROME RE26896p OS=Drosophila melanogaster OX=7227 GN=wun2 PE=2 SV=1
17	Q7KGH1	1.14e-38	141	350	0.322	0.286	Q7KGH1_DROME FI04477p OS=Drosophila melanogaster OX=7227 GN=wun2 PE=2 SV=1
18	A0A0B4LEJ6	1.15e-37	136	246	0.283	0.358	A0A0B4LEJ6_DROME Wunen-2, isoform B OS=Drosophila melanogaster OX=7227 GN=wun2 PE=3 SV=1
19	Q8TBJ4	1.60e-35	132	325	0.318	0.305	PLPR1_HUMAN Phospholipid phosphatase-related protein type 1 OS=Homo sapiens OX=9606 GN=PLPPR1 PE=1 SV=1
20	Q6WAY2	3.85e-35	131	325	0.315	0.302	PLPR1_RAT Phospholipid phosphatase-related protein type 1 OS=Rattus norvegicus OX=10116 GN=Plppr1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01569 PAP2	4.1e-24	96.4	PAP2 superfamily
2	PF14378 PAP2_3	1.1e+02	14.0	PAP2 superfamily
3	PF14360 PAP2_C	0.37	22.7	PAP2 superfamily C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360296

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315137	0.977	Sphingosine-1-phosphate phosphatase 2
2	9606.ENSP00000247225	0.974	Sphingosine-1-phosphate phosphatase 1
3	9606.ENSP00000245222	0.965	Sphingosine kinase 2
4	9606.ENSP00000362298	0.963	Sphingosine-1-phosphate lyase 1
5	9606.ENSP00000313681	0.954	Sphingosine kinase 1
6	9606.ENSP00000228027	0.939	Diacylglycerol O-acyltransferase 2
7	9606.ENSP00000314036	0.935	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
8	9606.ENSP00000376453	0.934	Ceramide synthase 6
9	9606.ENSP00000354829	0.932	Phosphatidylcholine:ceramide cholinephosphotransferase 1
10	9606.ENSP00000251363	0.930	Ceramide synthase 4
11	9606.ENSP00000284382	0.930	Ceramide synthase 3
12	9606.ENSP00000378176	0.929	Phosphatidylcholine:ceramide cholinephosphotransferase 2
13	9606.ENSP00000360761	0.928	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
14	9606.ENSP00000261407	0.927	Lysophospholipid acyltransferase 5
15	9606.ENSP00000271688	0.924	Ceramide synthase 2
16	9606.ENSP00000441980	0.924	Choline/ethanolaminephosphotransferase 1
17	9606.ENSP00000301452	0.921	Alkaline ceramidase 1
18	9606.ENSP00000311648	0.921	2-hydroxyacylsphingosine 1-beta-galactosyltransferase
19	9606.ENSP00000342609	0.919	Alkaline ceramidase 2
20	9606.ENSP00000381140	0.919	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042577	1.000	lipid phosphatase activity
GO:0008195	1.000	phosphatidate phosphatase activity
GO:0005178	1.000	integrin binding
GO:0042392	0.812	sphingosine-1-phosphate phosphatase activity
GO:0016462	0.676	pyrophosphatase activity
GO:0106235	0.454	ceramide-1-phosphate phosphatase activity
GO:0016740	0.377	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006629	0.988	lipid metabolic process
GO:0065007	0.961	biological regulation
GO:0006644	0.945	phospholipid metabolic process
GO:0050789	0.688	regulation of biological process
GO:1901576	0.668	organic substance biosynthetic process
GO:0050794	0.665	regulation of cellular process
GO:0044249	0.659	cellular biosynthetic process
GO:0008610	0.649	lipid biosynthetic process
GO:0006807	0.630	nitrogen compound metabolic process
GO:1901564	0.568	organonitrogen compound metabolic process
GO:0006665	0.539	sphingolipid metabolic process
GO:0050896	0.433	response to stimulus
GO:0030148	0.407	sphingolipid biosynthetic process
GO:0051716	0.399	cellular response to stimulus
GO:0043603	0.378	amide metabolic process
GO:0006672	0.328	ceramide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0012505	0.989	endomembrane system
GO:0043227	0.968	membrane-bounded organelle
GO:0005622	0.957	intracellular anatomical structure
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0005737	0.945	cytoplasm
GO:0031090	0.939	organelle membrane
GO:0031984	0.895	organelle subcompartment
GO:0005783	0.820	endoplasmic reticulum
GO:0005789	0.809	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:27429	1.000	a 1,2-diacyl-sn-glycero-3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate
EC:3.1.3.4	1.000	phosphatidate phosphatase.
RHEA:27518	0.812	H2O + sphing-4-enine 1-phosphate = phosphate + sphing-4-enine
EC:3.6.1.-	0.676	In phosphorus-containing anhydrides.
RHEA:50888	0.454	an N-acylsphingoid base 1-phosphate + H2O = an N-acyl-sphingoid base + phosphate
EC:2.-.-.-	0.377	Transferases.

[back to server]