StarFunc result for job id O14497

User Input

>input (2285 residues)
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEG
PAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEP
PGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPG
SGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLT
SPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQ
PYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQ
QQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPP
QELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPG
VSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQ
IHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQ
MHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAG
MAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPER
KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGS
MQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQ
KRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYS
PSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPP
AKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATAT
AATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQG
RNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAP
VPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPV
PASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGL
LAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPG
QRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASEN
SEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFE
SKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSS
TLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKR
CVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQG
VSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQ
DPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKN
PVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQN
PPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLF
LIGQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q4N7	0.290	0.295	0.000	2244	0.526	0.535	E9Q4N7.pdb.gz	ARI1B_MOUSE AT-rich interactive domain-containing protein 1B OS=Mus musculus OX=10090 GN=Arid1b PE=1 SV=2
2	AFDB:O14497	1.000	1.000	0.000	2285	1.000	1.000	O14497.pdb.gz	ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3
3	AFDB:Q8NFD5	0.290	0.296	0.000	2236	0.524	0.535	Q8NFD5.pdb.gz	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
4	AFDB:F1LNP1	0.284	0.362	3.042E-101	1751	0.457	0.596	F1LNP1.pdb.gz	F1LNP1_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=3
5	PDB:6lthL	0.203	0.987	4.747E-51	466	0.203	0.996	6lthL.pdb.gz	Structure of nucleosome-bound human BAF complex.
6	AFDB:Q9Y2F5	0.053	0.053	1.484E-4	2266	0.127	0.128	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
7	AFDB:O43432	0.045	0.055	9.781E-4	1585	0.082	0.119	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
8	PDB:5tbkA	0.070	0.255	1.323E-3	417	0.020	0.108	5tbkA.pdb.gz
9	PDB:2z6gA	0.070	0.242	1.496E-3	550	0.023	0.095	2z6gA.pdb.gz
10	PDB:4tnmA	0.082	0.366	1.692E-3	407	0.017	0.096	4tnmA.pdb.gz
11	PDB:7c4jI	0.112	0.400	1.913E-3	524	0.035	0.151	7c4jI.pdb.gz
12	PDB:6kbnC	0.085	0.347	2.348E-3	504	0.017	0.077	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
13	PDB:7anwA	0.074	0.223	2.767E-3	645	0.020	0.070	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
14	AFDB:Q9W517	0.092	0.117	4.457E-3	1741	0.097	0.128	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
15	AFDB:Q9VCH5	0.045	0.050	5.041E-3	1960	0.103	0.120	Q9VCH5.pdb.gz	NUP98_DROME Nuclear pore complex protein Nup98-Nup96 OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=1 SV=3
16	PDB:6hb3B	0.082	0.419	5.331E-3	360	0.017	0.106	6hb3B.pdb.gz
17	AFDB:Q9HCM3	0.025	0.028	5.471E-3	1950	0.121	0.142	Q9HCM3.pdb.gz	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
18	PDB:7nscE	0.066	0.160	5.554E-3	615	0.019	0.072	7nscE.pdb.gz
19	PDB:7cm7A	0.071	0.218	6.028E-3	620	0.020	0.074	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
20	AFDB:Q80XI3	0.043	0.053	6.187E-3	1579	0.093	0.134	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVD3	0.0	1762	2375	0.436	0.420	A0A0G2JVD3_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=1
2	A0A1B0GTJ8	0.0	1544	1495	0.387	0.592	A0A1B0GTJ8_HUMAN AT-rich interaction domain 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2
3	A0A1B0GTU5	0.0	3849	1903	0.833	1.000	A0A1B0GTU5_HUMAN AT-rich interaction domain 1A (Fragment) OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=1
4	A0A1B0GV63	0.0	1510	1349	0.365	0.617	A0A1B0GV63_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
5	A0A1B0GVK1	0.0	1642	1539	0.408	0.606	A0A1B0GVK1_HUMAN AT-rich interaction domain 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
6	A0A1B0GWJ2	0.0	1561	1479	0.388	0.599	A0A1B0GWJ2_HUMAN AT-rich interaction domain 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
7	A0A1B0GWZ0	0.0	1544	1864	0.381	0.467	A0A1B0GWZ0_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=2
8	A0A3F2YNW7	0.0	1800	2332	0.446	0.437	A0A3F2YNW7_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
9	A2BH40	0.0	3587	2283	0.947	0.948	ARI1A_MOUSE AT-rich interactive domain-containing protein 1A OS=Mus musculus OX=10090 GN=Arid1a PE=1 SV=1
10	E9Q4N7	0.0	1538	2306	0.381	0.377	ARI1B_MOUSE AT-rich interactive domain-containing protein 1B OS=Mus musculus OX=10090 GN=Arid1b PE=1 SV=2
11	F1LNP1	0.0	1714	1763	0.429	0.556	F1LNP1_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=3
12	H0Y488	0.0	3845	1901	0.832	1.000	H0Y488_HUMAN AT-rich interaction domain 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=2
13	H0Y7H8	0.0	1734	1758	0.436	0.567	H0Y7H8_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
14	O14497	0.0	4586	2285	1.000	1.000	ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3
15	Q8NFD5	0.0	1800	2319	0.446	0.439	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
16	H0Y2R3	3.54e-155	501	727	0.139	0.436	H0Y2R3_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2
17	Q8IN94	2.08e-83	309	2716	0.075	0.063	OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster OX=7227 GN=osa PE=1 SV=1
18	J7SA49	1.24e-54	214	1768	0.079	0.102	J7SA49_CAEEL ARID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=let-526 PE=1 SV=1
19	Q99856	5.17e-22	105	593	0.029	0.111	ARI3A_HUMAN AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2
20	Q62431	2.30e-21	103	601	0.024	0.092	ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus OX=10090 GN=Arid3a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	8.5e-11	53.7	ARID/BRIGHT DNA binding domain
2	PF12031 BAF250_C	2.3e-116	399.1	SWI/SNF-like complex subunit BAF250/Osa

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320485

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254480	0.999	SWI/SNF complex subunit SMARCC1
2	9606.ENSP00000263121	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
3	9606.ENSP00000265773	0.999	Probable global transcription activator SNF2L2
4	9606.ENSP00000267064	0.999	SWI/SNF complex subunit SMARCC2
5	9606.ENSP00000323967	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
6	9606.ENSP00000378414	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
7	9606.ENSP00000395654	0.999	Transcription activator BRG1
8	9606.ENSP00000397552	0.999	Actin-like protein 6A
9	9606.ENSP00000262188	0.996	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
10	9606.ENSP00000392617	0.996	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
11	9606.ENSP00000436901	0.996	Zinc finger protein ubi-d4
12	9606.ENSP00000414516	0.995	Protein SSXT
13	9606.ENSP00000341805	0.992	PHD finger protein 10
14	9606.ENSP00000310275	0.988	Barrier-to-autointegration factor
15	9606.ENSP00000344546	0.988	AT-rich interactive domain-containing protein 1B
16	9606.ENSP00000479526	0.988	Zinc finger protein DPF3
17	9606.ENSP00000349960	0.986	Actin, cytoplasmic 1
18	9606.ENSP00000233146	0.982	DNA mismatch repair protein Msh2
19	9606.ENSP00000262367	0.978	CREB-binding protein
20	9606.ENSP00000269305	0.972	Cellular tumor antigen p53

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.998	DNA binding
GO:0140297	0.977	DNA-binding transcription factor binding
GO:0061629	0.948	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.918	nuclear receptor binding
GO:0140110	0.413	transcription regulator activity
GO:0003824	0.346	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0010468	0.991	regulation of gene expression
GO:2001141	0.988	regulation of RNA biosynthetic process
GO:0050896	0.983	response to stimulus
GO:0006325	0.983	chromatin organization
GO:0006355	0.982	regulation of DNA-templated transcription
GO:0051716	0.966	cellular response to stimulus
GO:0006338	0.966	chromatin remodeling
GO:0007154	0.933	cell communication
GO:0023052	0.932	signaling
GO:0048518	0.886	positive regulation of biological process
GO:0042221	0.881	response to chemical
GO:0032502	0.866	developmental process
GO:0048522	0.860	positive regulation of cellular process
GO:0010604	0.836	positive regulation of macromolecule metabolic process
GO:0051173	0.825	positive regulation of nitrogen compound metabolic process
GO:0032501	0.821	multicellular organismal process
GO:0031325	0.792	positive regulation of cellular metabolic process
GO:0009719	0.768	response to endogenous stimulus
GO:0007165	0.756	signal transduction
GO:0045935	0.730	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.709	positive regulation of DNA-templated transcription
GO:0010033	0.669	response to organic substance
GO:0071824	0.668	protein-DNA complex subunit organization
GO:0070887	0.640	cellular response to chemical stimulus
GO:0030522	0.623	intracellular receptor signaling pathway
GO:0034728	0.585	nucleosome organization
GO:0048519	0.574	negative regulation of biological process
GO:0048856	0.565	anatomical structure development
GO:0048523	0.558	negative regulation of cellular process
GO:0071310	0.556	cellular response to organic substance
GO:0006357	0.551	regulation of transcription by RNA polymerase II
GO:0071495	0.550	cellular response to endogenous stimulus
GO:0022411	0.548	cellular component disassembly
GO:0032870	0.469	cellular response to hormone stimulus
GO:0045944	0.440	positive regulation of transcription by RNA polymerase II
GO:0007275	0.436	multicellular organism development
GO:0010628	0.434	positive regulation of gene expression
GO:0071704	0.405	organic substance metabolic process
GO:0009892	0.376	negative regulation of metabolic process
GO:0031324	0.366	negative regulation of cellular metabolic process
GO:0051172	0.363	negative regulation of nitrogen compound metabolic process
GO:0010605	0.340	negative regulation of macromolecule metabolic process
GO:0044238	0.333	primary metabolic process
GO:0006807	0.324	nitrogen compound metabolic process
GO:0006950	0.322	response to stress
GO:0043170	0.311	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	1.000	catalytic complex
GO:0000785	1.000	chromatin
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0070603	0.992	SWI/SNF superfamily-type complex
GO:0016514	0.941	SWI/SNF complex
GO:0005737	0.842	cytoplasm
GO:0005829	0.356	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]