StarFunc result for job id O14503

User Input

>input (412 residues)
MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTD
TDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14503	0.999	0.999	4.294E-59	412	1.000	1.000	O14503.pdb.gz	BHE40_HUMAN Class E basic helix-loop-helix protein 40 OS=Homo sapiens OX=9606 GN=BHLHE40 PE=1 SV=1
2	AFDB:Q0D311	0.241	0.246	1.345E-32	403	0.604	0.618	Q0D311.pdb.gz	Q0D311_DANRE Basic-helix-loop-helix protein OS=Danio rerio OX=7955 GN=dec1 PE=2 SV=1
3	AFDB:Q2PGD2	0.287	0.282	3.214E-21	421	0.442	0.432	Q2PGD2.pdb.gz	Q2PGD2_DANRE BHLH protein DEC2 OS=Danio rerio OX=7955 GN=bhlhb3l PE=2 SV=1
4	AFDB:Q9C0J9	0.291	0.255	2.809E-20	482	0.413	0.353	Q9C0J9.pdb.gz	BHE41_HUMAN Class E basic helix-loop-helix protein 41 OS=Homo sapiens OX=9606 GN=BHLHE41 PE=1 SV=1
5	AFDB:O35779	0.234	0.235	3.829E-20	410	0.447	0.449	O35779.pdb.gz	BHE41_RAT Class E basic helix-loop-helix protein 41 OS=Rattus norvegicus OX=10116 GN=Bhlhb3 PE=2 SV=2
6	AFDB:A0A0R4IAH0	0.094	0.050	1.513E-3	1052	0.163	0.064	A0A0R4IAH0.pdb.gz	A0A0R4IAH0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=wu:fa96d08 PE=1 SV=1
7	AFDB:Q5F3W0	0.102	0.043	2.991E-3	1170	0.109	0.038	Q5F3W0.pdb.gz	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
8	AFDB:Q5AAF4	0.076	0.038	4.614E-3	1485	0.150	0.042	Q5AAF4.pdb.gz	BNR1_CANAL Formin BNR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNR1 PE=1 SV=1
9	AFDB:P56524	0.117	0.057	4.909E-3	1084	0.175	0.066	P56524.pdb.gz	HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens OX=9606 GN=HDAC4 PE=1 SV=3
10	AFDB:A0A0U1RRM6	0.106	0.059	5.223E-3	802	0.197	0.101	A0A0U1RRM6.pdb.gz	A0A0U1RRM6_HUMAN ENAH actin regulator OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=1
11	PDB:6tuyA	0.146	0.100	3.380E-1	667	0.046	0.028	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
12	PDB:7ungi	0.101	0.154	3.380E-1	250	0.063	0.104	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:6v8oO	0.084	0.088	1.031	384	0.039	0.042	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
14	PDB:6n63A	0.109	0.285	1.321	141	0.046	0.135	6n63A.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.
15	PDB:5ee3B	0.109	0.122	1.590	364	0.022	0.025	5ee3B.pdb.gz	ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
16	PDB:7pntU	0.087	0.173	1.590	174	0.068	0.161	7pntU.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
17	PDB:6n3qF	0.081	0.164	1.692	190	0.051	0.111	6n3qF.pdb.gz
18	PDB:7suk5	0.102	0.134	1.692	296	0.036	0.051	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
19	PDB:5yfpG	0.089	0.068	1.800	615	0.044	0.029	5yfpG.pdb.gz
20	PDB:7un1FH	0.075	0.081	1.800	379	0.027	0.029	7un1FH.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14503	0.0	844	412	1.000	1.000	BHE40_HUMAN Class E basic helix-loop-helix protein 40 OS=Homo sapiens OX=9606 GN=BHLHE40 PE=1 SV=1
2	O35185	0.0	754	411	0.903	0.905	BHE40_MOUSE Class E basic helix-loop-helix protein 40 OS=Mus musculus OX=10090 GN=Bhlhe40 PE=1 SV=1
3	O35780	0.0	752	411	0.898	0.900	BHE40_RAT Class E basic helix-loop-helix protein 40 OS=Rattus norvegicus OX=10116 GN=Bhlhe40 PE=1 SV=1
4	Q6IB83	0.0	844	412	1.000	1.000	Q6IB83_HUMAN BHLHB2 protein OS=Homo sapiens OX=9606 GN=BHLHB2 PE=2 SV=1
5	Q0D311	1.29e-152	439	403	0.602	0.615	Q0D311_DANRE Basic-helix-loop-helix protein OS=Danio rerio OX=7955 GN=dec1 PE=2 SV=1
6	Q2PGD2	5.36e-86	270	421	0.420	0.411	Q2PGD2_DANRE BHLH protein DEC2 OS=Danio rerio OX=7955 GN=bhlhb3l PE=2 SV=1
7	O35779	6.43e-74	238	410	0.400	0.402	BHE41_RAT Class E basic helix-loop-helix protein 41 OS=Rattus norvegicus OX=10116 GN=Bhlhb3 PE=2 SV=2
8	Q99PV5	1.40e-72	234	410	0.400	0.402	BHE41_MOUSE Class E basic helix-loop-helix protein 41 OS=Mus musculus OX=10090 GN=Bhlhe41 PE=1 SV=1
9	Q9C0J9	3.81e-63	212	482	0.320	0.274	BHE41_HUMAN Class E basic helix-loop-helix protein 41 OS=Homo sapiens OX=9606 GN=BHLHE41 PE=1 SV=1
10	Q26263	1.53e-11	68.2	435	0.104	0.099	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
11	Q7TS99	3.04e-10	62.4	240	0.104	0.179	HELT_MOUSE Hairy and enhancer of split-related protein HELT OS=Mus musculus OX=10090 GN=Helt PE=1 SV=1
12	Q90Z12	4.92e-10	62.4	281	0.107	0.157	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
13	Q9DF41	5.30e-10	62.4	291	0.107	0.151	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
14	Q90VV1	8.64e-10	61.6	277	0.104	0.155	HES4B_XENLA Transcription factor HES-4-B OS=Xenopus laevis OX=8355 GN=hes4-b PE=1 SV=1
15	Q9HCC6	1.14e-09	60.5	221	0.109	0.204	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
16	Q6PBX3	1.65e-09	60.5	270	0.095	0.144	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
17	Q14469	1.94e-09	60.5	280	0.097	0.143	HES1_HUMAN Transcription factor HES-1 OS=Homo sapiens OX=9606 GN=HES1 PE=1 SV=1
18	O57337	2.03e-09	60.5	290	0.097	0.138	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
19	Q6XLQ0	2.08e-09	60.5	290	0.097	0.138	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
20	Q7KM13	2.08e-09	61.2	425	0.102	0.099	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07527 Hairy_orange	6.7e-09	47.2	Hairy Orange
2	PF00010 HLH	2.3e-09	48.4	Helix-loop-helix DNA-binding domain
3	PF10188 Oscp1	1.5e+02	13.8	Organic solute transport protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256495

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384517	0.979	Aryl hydrocarbon receptor nuclear translocator-like protein 1
2	9606.ENSP00000338283	0.977	Neuronal PAS domain-containing protein 2
3	9606.ENSP00000308741	0.958	Circadian locomoter output cycles protein kaput
4	9606.ENSP00000242728	0.935	Class E basic helix-loop-helix protein 41
5	9606.ENSP00000363128	0.908	Deleted in esophageal cancer 1
6	9606.ENSP00000232424	0.904	Transcription factor HES-1
7	9606.ENSP00000333283	0.901	Fanconi anemia core complex-associated protein 100
8	9606.ENSP00000442336	0.901	DNA topoisomerase 3-alpha
9	9606.ENSP00000466121	0.901	Fanconi anemia core complex-associated protein 24
10	9606.ENSP00000229769	0.900	Fanconi anemia group E protein
11	9606.ENSP00000267430	0.900	Fanconi anemia group M protein
12	9606.ENSP00000289081	0.900	Fanconi anemia group C protein
13	9606.ENSP00000308583	0.900	Centromere protein S
14	9606.ENSP00000317039	0.900	RecQ-mediated genome instability protein 1
15	9606.ENSP00000330875	0.900	Fanconi anemia group F protein
16	9606.ENSP00000347232	0.900	Bloom syndrome protein
17	9606.ENSP00000356243	0.900	Ubiquitin-conjugating enzyme E2 T
18	9606.ENSP00000367910	0.900	Fanconi anemia group G protein
19	9606.ENSP00000373952	0.900	Fanconi anemia group A protein
20	9606.ENSP00000381378	0.900	Fanconi anemia group B protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043425	1.000	bHLH transcription factor binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0070888	1.000	E-box binding
GO:0046982	0.998	protein heterodimerization activity
GO:0042802	0.978	identical protein binding
GO:0019904	0.935	protein domain specific binding
GO:0042803	0.914	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0045892	0.985	negative regulation of DNA-templated transcription
GO:0048511	0.896	rhythmic process
GO:0007623	0.830	circadian rhythm
GO:0006357	0.753	regulation of transcription by RNA polymerase II
GO:0050896	0.662	response to stimulus
GO:0000122	0.407	negative regulation of transcription by RNA polymerase II
GO:0032922	0.366	circadian regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.700	nuclear body
GO:0005737	0.553	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]