StarFunc result for job id O14508

User Input

>input (198 residues)
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14508	1.000	1.000	2.075E-39	198	1.000	1.000	O14508.pdb.gz	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
2	AFDB:V9Q4K1	0.800	0.792	2.016E-24	200	0.525	0.520	V9Q4K1.pdb.gz	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
3	AFDB:Q08BW5	0.781	0.732	8.754E-20	212	0.434	0.406	Q08BW5.pdb.gz	Q08BW5_DANRE Cytokine-inducible SH2-containing protein OS=Danio rerio OX=7955 GN=CISH PE=2 SV=1
4	AFDB:Q9NSE2	0.791	0.612	1.184E-19	258	0.449	0.345	Q9NSE2.pdb.gz	CISH_HUMAN Cytokine-inducible SH2-containing protein OS=Homo sapiens OX=9606 GN=CISH PE=1 SV=1
5	AFDB:B5XCB4	0.772	0.682	6.809E-19	225	0.414	0.364	B5XCB4.pdb.gz	B5XCB4_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
6	AFDB:L0N8K9	0.699	0.670	3.615E-16	207	0.318	0.304	L0N8K9.pdb.gz
7	AFDB:O35716	0.684	0.640	4.888E-16	212	0.308	0.288	O35716.pdb.gz	SOCS1_MOUSE Suppressor of cytokine signaling 1 OS=Mus musculus OX=10090 GN=Socs1 PE=1 SV=1
8	AFDB:Q6DEF9	0.681	0.671	1.363E-15	201	0.298	0.294	Q6DEF9.pdb.gz	Q6DEF9_DANRE Socs1 protein OS=Danio rerio OX=7955 GN=SOCS1 PE=2 SV=1
9	AFDB:O14543	0.695	0.617	2.987E-15	225	0.313	0.276	O14543.pdb.gz	SOCS3_HUMAN Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1
10	AFDB:M9PHY7	0.553	0.117	1.523E-14	1021	0.268	0.052	M9PHY7.pdb.gz	M9PHY7_DROME Suppressor of cytokine signaling at 16D, isoform B OS=Drosophila melanogaster OX=7227 GN=Socs16D PE=4 SV=1
11	PDB:8dcxB	0.418	0.357	4.474E-7	236	0.197	0.165	8dcxB.pdb.gz
12	PDB:7myoB	0.414	0.296	3.084E-6	286	0.187	0.129	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
13	PDB:1k9aB	0.410	0.192	1.163E-5	441	0.116	0.052	1k9aB.pdb.gz
14	PDB:4fl2A	0.411	0.157	1.774E-5	555	0.121	0.043	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:3ps5A	0.423	0.174	2.875E-5	529	0.152	0.057	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
16	PDB:4gwfA	0.434	0.187	3.445E-5	497	0.157	0.062	4gwfA.pdb.gz
17	PDB:4k2rA	0.433	0.169	3.659E-5	551	0.141	0.051	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
18	PDB:5xzrA	0.429	0.170	3.659E-5	519	0.131	0.050	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
19	PDB:1ka6A	0.440	0.776	4.129E-5	107	0.081	0.150	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
20	PDB:1griA	0.391	0.368	9.045E-5	211	0.126	0.118	1griA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14508	7.99e-149	412	198	1.000	1.000	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
2	O35717	9.79e-140	389	198	0.939	0.939	SOCS2_MOUSE Suppressor of cytokine signaling 2 OS=Mus musculus OX=10090 GN=Socs2 PE=1 SV=1
3	O88582	7.87e-139	387	198	0.934	0.934	SOCS2_RAT Suppressor of cytokine signaling 2 OS=Rattus norvegicus OX=10116 GN=Socs2 PE=2 SV=1
4	V9Q4K1	1.47e-73	222	200	0.515	0.510	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
5	V9Q6E2	6.16e-73	221	200	0.510	0.505	V9Q6E2_SALSA Suppressor of cytokine signaling 2a OS=Salmo salar OX=8030 GN=SOCS2a PE=2 SV=1
6	Q9NSE2	5.08e-49	162	258	0.439	0.337	CISH_HUMAN Cytokine-inducible SH2-containing protein OS=Homo sapiens OX=9606 GN=CISH PE=1 SV=1
7	O70512	1.78e-48	160	256	0.424	0.328	CISH_RAT Cytokine-inducible SH2-containing protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Cish PE=2 SV=1
8	Q62225	3.94e-48	159	257	0.419	0.323	CISH_MOUSE Cytokine-inducible SH2-containing protein OS=Mus musculus OX=10090 GN=Cish PE=1 SV=1
9	Q08BW5	2.80e-41	140	212	0.394	0.368	Q08BW5_DANRE Cytokine-inducible SH2-containing protein OS=Danio rerio OX=7955 GN=CISH PE=2 SV=1
10	B9EPA9	1.72e-37	131	225	0.379	0.333	B9EPA9_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
11	B5XCB4	8.73e-35	124	225	0.404	0.356	B5XCB4_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
12	Q7ZUC6	2.94e-25	99.4	207	0.298	0.285	Q7ZUC6_DANRE Suppressor of cytokine signaling 3 OS=Danio rerio OX=7955 GN=fj09e12 PE=2 SV=1
13	O14544	9.87e-24	99.8	535	0.298	0.110	SOCS6_HUMAN Suppressor of cytokine signaling 6 OS=Homo sapiens OX=9606 GN=SOCS6 PE=1 SV=2
14	O15524	1.54e-23	94.7	211	0.288	0.270	SOCS1_HUMAN Suppressor of cytokine signaling 1 OS=Homo sapiens OX=9606 GN=SOCS1 PE=1 SV=1
15	Q4JHT5	1.54e-23	94.7	211	0.288	0.270	Q4JHT5_HUMAN Suppressor of cytokine signaling 1 OS=Homo sapiens OX=9606 GN=SOCS1 PE=2 SV=1
16	Q9JLY0	1.60e-23	99.0	533	0.298	0.111	SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2
17	O35716	5.22e-23	93.6	212	0.278	0.259	SOCS1_MOUSE Suppressor of cytokine signaling 1 OS=Mus musculus OX=10090 GN=Socs1 PE=1 SV=1
18	Q9QX78	7.40e-23	93.2	212	0.283	0.264	SOCS1_RAT Suppressor of cytokine signaling 1 OS=Rattus norvegicus OX=10116 GN=Socs1 PE=3 SV=1
19	Q6DEF9	8.14e-23	92.8	201	0.293	0.289	Q6DEF9_DANRE Socs1 protein OS=Danio rerio OX=7955 GN=SOCS1 PE=2 SV=1
20	O14543	1.80e-22	92.4	225	0.298	0.262	SOCS3_HUMAN Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00668 Condensation	2e+02	12.0	Condensation domain
2	PF00017 SH2	9.6e-09	46.6	SH2 domain
3	PF14633 SH2_2	1	20.3	SH2 domain
4	PF07525 SOCS_box	2.6e-09	48.6	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481249

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376808	0.999	Cullin-5
2	9606.ENSP00000478121	0.999	Elongin-C
3	9606.ENSP00000262306	0.998	Elongin-B
4	9606.ENSP00000293328	0.981	Signal transducer and activator of transcription 5B
5	9606.ENSP00000483403	0.975	Growth hormone receptor
6	9606.ENSP00000341208	0.972	Signal transducer and activator of transcription 5A
7	9606.ENSP00000343204	0.958	Tyrosine-protein kinase JAK1
8	9606.ENSP00000329418	0.957	Suppressor of cytokine signaling 1
9	9606.ENSP00000337825	0.944	Tyrosine-protein kinase Lck
10	9606.ENSP00000371067	0.944	Tyrosine-protein kinase JAK2
11	9606.ENSP00000268035	0.943	Insulin-like growth factor 1 receptor
12	9606.ENSP00000330341	0.943	Suppressor of cytokine signaling 3
13	9606.ENSP00000216223	0.909	Interleukin-2 receptor subunit beta
14	9606.ENSP00000441543	0.905	Polyubiquitin-C
15	9606.ENSP00000388107	0.902	Ubiquitin-60S ribosomal protein L40
16	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
17	9606.ENSP00000304697	0.900	Polyubiquitin-B
18	9606.ENSP00000264657	0.890	Signal transducer and activator of transcription 3
19	9606.ENSP00000354394	0.860	Signal transducer and activator of transcription 1-alpha/beta
20	9606.ENSP00000303830	0.859	Insulin receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0030674	0.976	protein-macromolecule adaptor activity
GO:0035591	0.831	signaling adaptor activity
GO:0005159	0.825	insulin-like growth factor receptor binding
GO:0005126	0.686	cytokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0051716	0.995	cellular response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0023052	0.992	signaling
GO:0007165	0.983	signal transduction
GO:0042221	0.958	response to chemical
GO:0007166	0.955	cell surface receptor signaling pathway
GO:0097696	0.953	receptor signaling pathway via STAT
GO:0048519	0.927	negative regulation of biological process
GO:1901652	0.923	response to peptide
GO:0048523	0.915	negative regulation of cellular process
GO:0007259	0.881	receptor signaling pathway via JAK-STAT
GO:0043434	0.875	response to peptide hormone
GO:0048518	0.861	positive regulation of biological process
GO:0048522	0.797	positive regulation of cellular process
GO:0048583	0.792	regulation of response to stimulus
GO:0071375	0.785	cellular response to peptide hormone stimulus
GO:0032502	0.758	developmental process
GO:0019222	0.637	regulation of metabolic process
GO:0010646	0.620	regulation of cell communication
GO:0023051	0.618	regulation of signaling
GO:0009966	0.596	regulation of signal transduction
GO:0060255	0.521	regulation of macromolecule metabolic process
GO:0007167	0.495	enzyme-linked receptor protein signaling pathway
GO:0032501	0.462	multicellular organismal process
GO:0051239	0.459	regulation of multicellular organismal process
GO:0031323	0.458	regulation of cellular metabolic process
GO:0007169	0.447	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048856	0.438	anatomical structure development
GO:0048585	0.423	negative regulation of response to stimulus
GO:0008152	0.400	metabolic process
GO:0060416	0.378	response to growth hormone
GO:0014070	0.366	response to organic cyclic compound
GO:0080090	0.343	regulation of primary metabolic process
GO:0051171	0.332	regulation of nitrogen compound metabolic process
GO:0010941	0.327	regulation of cell death
GO:0042981	0.322	regulation of apoptotic process
GO:0050793	0.320	regulation of developmental process
GO:0071704	0.305	organic substance metabolic process
GO:0009893	0.300	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.832	organelle
GO:0043229	0.824	intracellular organelle
GO:0043227	0.818	membrane-bounded organelle
GO:0043231	0.813	intracellular membrane-bounded organelle
GO:0016020	0.798	membrane
GO:0043233	0.695	organelle lumen
GO:0070013	0.694	intracellular organelle lumen
GO:0005634	0.607	nucleus
GO:0005654	0.532	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]