StarFunc result for job id O14511

User Input

>input (850 residues)
MRQVCCSALPPPPLEKGRCSSYSDSSSSSSERSSSSSSSSSESGSSSRSSSNNSSISRPA
APPEPRPQQQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSV
QDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVI
SVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLK
KMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNK
VKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCY
YIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTITGICVALLVVG
IVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPA
TDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLS
SVGTSKCNSPACVEARARRAAAYNLEERRRATAPPYHDSVDSLRDSPHSERYVSALTTPA
RLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLAEQQPLLRHPAPPGPGPGP
GPGPGPGADMQRSYDSYYYPAAGPGPRRGTCALGGSLGSLPASPFRIPEDDEYETTQECA
PPPPPRPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASASDDD
ADDADGALAAESTPFLGLRGAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPP
PRAKQDSAPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35569	0.316	0.310	0.000	868	0.949	0.930	O35569.pdb.gz	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1
2	AFDB:Q90X22	0.121	0.083	3.449E-9	1276	0.127	0.085	Q90X22.pdb.gz
3	AFDB:Q924C5	0.130	0.070	6.059E-9	1678	0.142	0.072	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
4	AFDB:Q9VZT8	0.118	0.075	4.355E-8	1443	0.154	0.091	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
5	PDB:6feyD	0.104	0.529	4.959E-7	160	0.042	0.225	6feyD.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
6	AFDB:O14917	0.109	0.086	9.658E-7	1159	0.135	0.099	O14917.pdb.gz	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
7	PDB:1e07A	0.134	0.169	1.091E-6	642	0.041	0.055	1e07A.pdb.gz
8	AFDB:P91643	0.104	0.101	1.144E-6	880	0.111	0.107	P91643.pdb.gz	P91643_DROME KEK1 OS=Drosophila melanogaster OX=7227 GN=kek1 PE=1 SV=1
9	PDB:4edqA	0.097	0.166	1.447E-6	483	0.024	0.041	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
10	PDB:6feyB	0.099	0.374	2.689E-6	207	0.045	0.184	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
11	AFDB:A0A024R064	0.099	0.099	3.336E-6	852	0.127	0.127	A0A024R064.pdb.gz
12	AFDB:A0A0B4K6Z6	0.112	0.048	3.336E-6	2037	0.144	0.060	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
13	PDB:3oaiA	0.101	0.168	4.724E-6	488	0.028	0.049	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
14	PDB:5ir3A	0.098	0.618	5.594E-6	111	0.019	0.144	5ir3A.pdb.gz
15	PDB:5oj2B	0.106	0.129	7.008E-6	692	0.049	0.061	5oj2B.pdb.gz
16	PDB:5c6wJ	0.093	0.299	7.414E-6	238	0.019	0.067	5c6wJ.pdb.gz
17	PDB:6dlfA	0.101	0.333	8.780E-6	236	0.024	0.085	6dlfA.pdb.gz
18	PDB:5hhmI	0.100	0.382	1.542E-5	196	0.022	0.097	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
19	AFDB:A0A2R8QME5	0.112	0.094	5.907E-5	1094	0.122	0.095	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
20	AFDB:E7F5U2	0.109	0.045	4.245E-4	2497	0.116	0.040	E7F5U2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14511	0.0	1730	850	1.000	1.000	NRG2_HUMAN Pro-neuregulin-2, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG2 PE=1 SV=1
2	O35569	0.0	1351	868	0.860	0.842	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1
3	P56974	0.0	1306	756	0.834	0.938	NRG2_MOUSE Pro-neuregulin-2, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg2 PE=1 SV=1
4	A5D6U9	1.62e-115	362	488	0.204	0.355	A5D6U9_DANRE Neuregulin 2a OS=Danio rerio OX=7955 GN=nrg2a PE=2 SV=1
5	A0A0R4IDP7	5.88e-104	339	725	0.264	0.309	A0A0R4IDP7_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
6	A0A0R4IPH3	1.19e-102	336	722	0.260	0.306	A0A0R4IPH3_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
7	A0A0R4IBM0	1.57e-101	333	730	0.259	0.301	A0A0R4IBM0_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
8	Q02297	5.14e-92	305	640	0.282	0.375	NRG1_HUMAN Pro-neuregulin-1, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=3
9	A0A494C1F8	5.74e-92	304	607	0.279	0.390	A0A494C1F8_HUMAN Pro-neuregulin-1, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
10	Q6DR98	1.08e-88	296	645	0.268	0.353	NRG1_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
11	P43322	2.10e-85	288	662	0.273	0.350	NRG1_RAT Pro-neuregulin-1, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg1 PE=1 SV=1
12	B3DK99	1.68e-80	273	599	0.205	0.290	B3DK99_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=2 SV=1
13	A0A1B4Z255	1.08e-77	265	604	0.200	0.281	A0A1B4Z255_DANRE Neuregulin1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=2 SV=1
14	Q6DR99	8.93e-68	241	700	0.226	0.274	Q6DR99_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
15	A0A0R4IFE6	2.99e-57	211	687	0.154	0.191	A0A0R4IFE6_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
16	A0A494C1G2	3.50e-28	119	387	0.073	0.160	A0A494C1G2_HUMAN Neuregulin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
17	A0A494C114	1.32e-25	107	207	0.068	0.280	A0A494C114_HUMAN Neuregulin 1 OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
18	Q6PK61	5.77e-22	98.2	241	0.074	0.261	Q6PK61_HUMAN Neuregulin 1 OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
19	A0A494C054	7.82e-20	89.4	155	0.055	0.303	A0A494C054_HUMAN Neuregulin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
20	O35181	3.88e-15	82.0	713	0.046	0.055	NRG3_MOUSE Pro-neuregulin-3, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	32	16.0	CD80-like C2-set immunoglobulin domain
2	PF00008 EGF	1.7e+02	13.9	EGF-like domain
3	PF07679 I-set	1.1e-13	62.4	Immunoglobulin I-set domain
4	PF00047 ig	1.2e-09	49.5	Immunoglobulin domain
5	PF13895 Ig_2	1.6e-06	39.7	Immunoglobulin domain
6	PF13927 Ig_3	3.1e-12	58.2	Immunoglobulin domain
7	PF18452 Ig_6	0.48	21.7	Immunoglobulin domain
8	PF02158 Neuregulin	5.3e-141	481.7	Neuregulin intracellular region
9	PF07686 V-set	31	16.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354910

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267101	0.999	Receptor tyrosine-protein kinase erbB-3
2	9606.ENSP00000342235	0.999	Receptor tyrosine-protein kinase erbB-4
3	9606.ENSP00000275493	0.996	Epidermal growth factor receptor
4	9606.ENSP00000269571	0.989	Receptor tyrosine-protein kinase erbB-2
5	9606.ENSP00000378367	0.981	Pro-neuregulin-4, membrane-bound isoform
6	9606.ENSP00000361214	0.947	Pro-neuregulin-3, membrane-bound isoform
7	9606.ENSP00000256078	0.930	GTPase KRas
8	9606.ENSP00000407586	0.930	GTPase HRas
9	9606.ENSP00000335153	0.925	Heat shock protein HSP 90-alpha
10	9606.ENSP00000263025	0.922	Mitogen-activated protein kinase 3
11	9606.ENSP00000358548	0.921	GTPase NRas
12	9606.ENSP00000309968	0.917	Disintegrin and metalloproteinase domain-containing protein 17
13	9606.ENSP00000215832	0.915	Mitogen-activated protein kinase 1
14	9606.ENSP00000384620	0.912	Pro-neuregulin-1, membrane-bound isoform
15	9606.ENSP00000248594	0.906	Tyrosine-protein phosphatase non-receptor type 12
16	9606.ENSP00000263967	0.904	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
17	9606.ENSP00000428056	0.904	Phosphatidylinositol 3-kinase regulatory subunit alpha
18	9606.ENSP00000326366	0.903	Presenilin-1
19	9606.ENSP00000426632	0.902	Erbin
20	9606.ENSP00000222005	0.900	Hsp90 co-chaperone Cdc37

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.998	signaling receptor binding
GO:0048018	0.991	receptor ligand activity
GO:0005154	0.990	epidermal growth factor receptor binding
GO:0003824	0.988	catalytic activity
GO:0140096	0.977	catalytic activity, acting on a protein
GO:0038023	0.965	signaling receptor activity
GO:0004888	0.962	transmembrane signaling receptor activity
GO:0016773	0.962	phosphotransferase activity, alcohol group as acceptor
GO:0016301	0.962	kinase activity
GO:0004672	0.923	protein kinase activity
GO:0004713	0.911	protein tyrosine kinase activity
GO:0004714	0.883	transmembrane receptor protein tyrosine kinase activity
GO:1990631	0.528	ErbB-4 class receptor binding
GO:0043125	0.508	ErbB-3 class receptor binding
GO:0005006	0.490	epidermal growth factor receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0050896	0.997	response to stimulus
GO:0007165	0.990	signal transduction
GO:0007166	0.784	cell surface receptor signaling pathway
GO:0007169	0.745	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0038127	0.672	ERBB signaling pathway
GO:0007173	0.489	epidermal growth factor receptor signaling pathway
GO:0051128	0.484	regulation of cellular component organization
GO:0050793	0.316	regulation of developmental process
GO:0065008	0.310	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.926	extracellular space
GO:0071944	0.895	cell periphery
GO:0005886	0.891	plasma membrane
GO:0043227	0.798	membrane-bounded organelle
GO:0030054	0.602	cell junction
GO:0005829	0.408	cytosol
GO:0031982	0.367	vesicle
GO:0043231	0.365	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.962	Phosphotransferases with an alcohol group as acceptor.
RHEA:10596	0.911	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.883	receptor protein-tyrosine kinase.

[back to server]