StarFunc result for job id O14512

User Input

>input (581 residues)
MVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQL
AALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLSRGEQ
QQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGE
LAASAASLTDMGGSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGL
TSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIA
PIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDG
SFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIM
HSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPL
PKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5F9YLF9	0.352	0.320	1.990E-83	645	1.000	0.901	A0A5F9YLF9.pdb.gz	A0A5F9YLF9_HUMAN Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=1
2	AFDB:Q86P82	0.191	0.178	4.061E-14	634	0.217	0.199	Q86P82.pdb.gz	Q86P82_DROME SD04308p OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=2 SV=1
3	PDB:8dcxB	0.155	0.362	5.802E-8	236	0.076	0.186	8dcxB.pdb.gz
4	PDB:7myoB	0.165	0.322	4.872E-7	286	0.072	0.147	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
5	PDB:4fl2A	0.143	0.149	6.750E-6	555	0.059	0.061	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
6	AFDB:Q8IZW8	0.141	0.117	1.153E-5	715	0.181	0.147	Q8IZW8.pdb.gz	TENS4_HUMAN Tensin-4 OS=Homo sapiens OX=9606 GN=TNS4 PE=1 SV=3
7	PDB:4gwfA	0.164	0.189	2.847E-5	497	0.060	0.070	4gwfA.pdb.gz
8	AFDB:Q63HR2	0.149	0.066	5.867E-5	1409	0.169	0.070	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
9	PDB:1ka6A	0.150	0.706	8.251E-5	107	0.046	0.252	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
10	PDB:1k9aB	0.137	0.179	1.128E-4	441	0.036	0.048	1k9aB.pdb.gz
11	PDB:3ps5A	0.152	0.166	1.128E-4	529	0.043	0.047	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
12	PDB:4k2rA	0.137	0.143	1.279E-4	551	0.057	0.060	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:1griA	0.138	0.361	1.543E-4	211	0.046	0.128	1griA.pdb.gz
14	PDB:5xzrA	0.162	0.180	1.749E-4	519	0.059	0.066	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
15	AFDB:Q5SSZ5	0.146	0.068	2.805E-4	1440	0.186	0.075	Q5SSZ5.pdb.gz	TENS3_MOUSE Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1
16	AFDB:Q8MQW8	0.144	0.051	4.628E-4	1789	0.157	0.051	Q8MQW8.pdb.gz	SPRI_DROME Protein sprint OS=Drosophila melanogaster OX=7227 GN=spri PE=2 SV=3
17	AFDB:Q9HBL0	0.134	0.049	1.260E-3	1735	0.158	0.053	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
18	AFDB:F8WAL6	0.060	0.063	4.521E-1	542	0.146	0.157	F8WAL6.pdb.gz	F8WAL6_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=3
19	AFDB:Q9LL45	0.066	0.062	8.453E-1	633	0.139	0.128	Q9LL45.pdb.gz	TBP1_ORYSJ Telomere-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=TBP1 PE=1 SV=2
20	AFDB:Q389H8	0.065	0.061	9.580E-1	634	0.122	0.112	Q389H8.pdb.gz	Q389H8_TRYB2 PSP1 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0280 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X1Q5	0.0	851	553	0.941	0.989	A0A087X1Q5_HUMAN Suppressor of cytokine signaling 7 (Fragment) OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=2
2	A0A5F9YLF9	0.0	1150	645	1.000	0.901	A0A5F9YLF9_HUMAN Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=1
3	O14512	0.0	1151	581	1.000	1.000	SOCS7_HUMAN Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=2
4	Q8VHQ2	0.0	1114	579	0.974	0.978	SOCS7_MOUSE Suppressor of cytokine signaling 7 OS=Mus musculus OX=10090 GN=Socs7 PE=1 SV=1
5	M9PHY7	2.66e-48	183	1021	0.174	0.099	M9PHY7_DROME Suppressor of cytokine signaling at 16D, isoform B OS=Drosophila melanogaster OX=7227 GN=Socs16D PE=4 SV=1
6	O14544	5.87e-48	177	535	0.155	0.168	SOCS6_HUMAN Suppressor of cytokine signaling 6 OS=Homo sapiens OX=9606 GN=SOCS6 PE=1 SV=2
7	Q9JLY0	8.91e-48	177	533	0.155	0.169	SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2
8	Q9VX18	2.60e-47	180	1016	0.170	0.097	Q9VX18_DROME Suppressor of cytokine signaling at 16D, isoform A OS=Drosophila melanogaster OX=7227 GN=Socs16D PE=4 SV=4
9	Q7JVF1	1.17e-22	101	342	0.096	0.164	Q7JVF1_DROME LP02169p OS=Drosophila melanogaster OX=7227 GN=Socs44A PE=2 SV=1
10	O14508	2.98e-19	88.2	198	0.098	0.288	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
11	O88582	8.42e-19	87.0	198	0.095	0.278	SOCS2_RAT Suppressor of cytokine signaling 2 OS=Rattus norvegicus OX=10116 GN=Socs2 PE=2 SV=1
12	O35717	1.39e-18	86.3	198	0.095	0.278	SOCS2_MOUSE Suppressor of cytokine signaling 2 OS=Mus musculus OX=10090 GN=Socs2 PE=1 SV=1
13	O70512	6.26e-17	83.2	256	0.095	0.215	CISH_RAT Cytokine-inducible SH2-containing protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Cish PE=2 SV=1
14	Q62225	6.24e-16	80.1	257	0.095	0.214	CISH_MOUSE Cytokine-inducible SH2-containing protein OS=Mus musculus OX=10090 GN=Cish PE=1 SV=1
15	V9Q4K1	6.54e-16	78.6	200	0.093	0.270	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
16	Q9NSE2	1.44e-15	79.0	258	0.095	0.213	CISH_HUMAN Cytokine-inducible SH2-containing protein OS=Homo sapiens OX=9606 GN=CISH PE=1 SV=1
17	Q86P82	2.33e-15	81.6	634	0.088	0.080	Q86P82_DROME SD04308p OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=2 SV=1
18	Q9VJA1	2.43e-15	81.6	633	0.088	0.081	Q9VJA1_DROME Suppressor of cytokine signaling SOCS36E OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=2 SV=2
19	Q8INY1	4.37e-15	80.9	737	0.088	0.069	Q8INY1_DROME Suppressor of cytokine signaling at 36E, isoform D OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=4 SV=2
20	V9Q6E2	4.96e-15	76.3	200	0.088	0.255	V9Q6E2_SALSA Suppressor of cytokine signaling 2a OS=Salmo salar OX=8030 GN=SOCS2a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	3.7e-05	35.1	SH2 domain
2	PF07525 SOCS_box	1.2e-05	36.8	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482229

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376808	0.969	Cullin-5
2	9606.ENSP00000371067	0.953	Tyrosine-protein kinase JAK2
3	9606.ENSP00000264657	0.911	Signal transducer and activator of transcription 3
4	9606.ENSP00000293328	0.890	Signal transducer and activator of transcription 5B
5	9606.ENSP00000341208	0.887	Signal transducer and activator of transcription 5A
6	9606.ENSP00000417273	0.886	Cytoplasmic protein NCK1
7	9606.ENSP00000478121	0.869	Elongin-C
8	9606.ENSP00000262306	0.867	Elongin-B
9	9606.ENSP00000343204	0.866	Tyrosine-protein kinase JAK1
10	9606.ENSP00000341524	0.863	Septin-6
11	9606.ENSP00000354394	0.843	Signal transducer and activator of transcription 1-alpha/beta
12	9606.ENSP00000381992	0.817	Septin-7
13	9606.ENSP00000391676	0.795	Tyrosine-protein kinase JAK3
14	9606.ENSP00000431885	0.789	Non-receptor tyrosine-protein kinase TYK2
15	9606.ENSP00000361202	0.743	Insulin receptor substrate 4
16	9606.ENSP00000305133	0.710	Suppressor of cytokine signaling 5
17	9606.ENSP00000329418	0.656	Suppressor of cytokine signaling 1
18	9606.ENSP00000240123	0.654	Vinexin
19	9606.ENSP00000409346	0.644	Cytokine-inducible SH2-containing protein
20	9606.ENSP00000330341	0.642	Suppressor of cytokine signaling 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005102	0.343	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0051716	0.985	cellular response to stimulus
GO:0043170	0.982	macromolecule metabolic process
GO:0007165	0.978	signal transduction
GO:0032501	0.967	multicellular organismal process
GO:0044238	0.964	primary metabolic process
GO:0032502	0.949	developmental process
GO:0019538	0.887	protein metabolic process
GO:0007166	0.850	cell surface receptor signaling pathway
GO:0042221	0.838	response to chemical
GO:0070887	0.828	cellular response to chemical stimulus
GO:0010033	0.825	response to organic substance
GO:0071310	0.806	cellular response to organic substance
GO:0048518	0.769	positive regulation of biological process
GO:0048522	0.707	positive regulation of cellular process
GO:0007169	0.681	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009719	0.671	response to endogenous stimulus
GO:0019222	0.641	regulation of metabolic process
GO:0036211	0.629	protein modification process
GO:0071495	0.603	cellular response to endogenous stimulus
GO:0048856	0.563	anatomical structure development
GO:1901701	0.559	cellular response to oxygen-containing compound
GO:0009725	0.549	response to hormone
GO:1901653	0.514	cellular response to peptide
GO:0071375	0.492	cellular response to peptide hormone stimulus
GO:0007275	0.470	multicellular organism development
GO:0031323	0.438	regulation of cellular metabolic process
GO:0048519	0.416	negative regulation of biological process
GO:0048583	0.404	regulation of response to stimulus
GO:0048731	0.403	system development
GO:0032869	0.394	cellular response to insulin stimulus
GO:0048523	0.393	negative regulation of cellular process
GO:0030154	0.389	cell differentiation
GO:0080090	0.381	regulation of primary metabolic process
GO:0060255	0.375	regulation of macromolecule metabolic process
GO:0070647	0.368	protein modification by small protein conjugation or removal
GO:0044237	0.359	cellular metabolic process
GO:0023051	0.357	regulation of signaling
GO:0051171	0.352	regulation of nitrogen compound metabolic process
GO:0016477	0.349	cell migration
GO:0007420	0.349	brain development
GO:0010646	0.346	regulation of cell communication
GO:0042063	0.343	gliogenesis
GO:0032446	0.337	protein modification by small protein conjugation
GO:0009966	0.327	regulation of signal transduction
GO:0008286	0.321	insulin receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.512	protein-containing complex
GO:0043229	0.375	intracellular organelle
GO:0043231	0.372	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]