StarFunc result for job id O14513

User Input

>input (1909 residues)
MEGKRQLEKRDFGKRLSLDSSLVEYMDSNKYIEHLLTQLEEQHRSLWREKLAVARLQREV
AQRTSEGAMHEKLIHELEEERHLRLQSEKRLQEVTLESERNRIQMRSLQQQFSRMEETVR
NLLQSQGSPEQKKEETVNIMVYQEKLSEEERKHKEALEDLHMVVDEDSRSESSSTDEGKE
KTKLLLERLKALEAENSALALENENQREQYERCLDEVANQVVQALLTQKDLREECVKLKT
RVFDLEQQNRTLSILFQQRVRPTSDLLLQKLHSRLLDLSSGDLLSEVERNRSLTQSRTDA
EVHEHQLNTKSALKCPGLGAVIPGHLCPRNSYSSSSELSLSSTCSEYSSGSSYTWHDGKN
LRKRQSSQNWDKRLSIDSSLPSGFASPTNELPPTRIKESHILEGLRKLQKRKVLLEPPSV
ITKWGYKDCMNSNEGIYSPGIKSSSLKEYPPCKTADLGSPCKEPHKTFVYDLDSHVDADD
DPSTLALLQAVPNQSCRPHGSKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSC
ASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSDTDDNETFDELHIESSDEKS
PSDVSLAADTDKSVENLDVLVGFGKSLCGSPEEEEKQVPIPSETRPKTFSFIKQQRVVKR
TSSEECVTVIFDAEDGEPIEFSSHQTGVVTVTRNEISINSTPAGPKAEHTELLPQGIACL
QPRAAARDYTFFKRSEEDTEKNIPKDNVDNVPRVSTESFSSRTVTQNPQQQKLVKPTHNI
SCQSNSRSSAPMGIYQKQNLTKIPPRGKSSPQKSKLMEPEATTLLPSSGLVTLEKSPALA
PGKLSRFMKTESSGPLFELRSDPHIPKHSAQLPHSSRMPSRRDWVQCPKSQTPGSRSRPA
IESSDSGEPPTRDEHCGSGPEAGVKSPSPPPPPGRSVSLLARPSYDYSPAPSSTKSETRV
PSETARTPFKSPLLKGISAPVISSNPATTEVQRKKPSVAFKKPIFTHPMPSPEAVIQTRC
PAHAPSSSFTVMALGPPKVSPKRGVPKTSPRQTLGTPQRDIGLQTPRISPSTHEPLEMTS
SKSVSPGRKGQLNDSASTPPKPSFLGVNESPSSQVSSSSSSSSPAKSHNSPHGCQSAHEK
GLKTRLPVGLKVLMKSPQLLRKSSTVPGKHEKDSLNEASKSSVAVNKSKPEDSKNPASME
ITAGERNVTLPDSQAQGSLADGLPLETALQEPLESSIPGSDGRDGVDNRSMRRSLSSSKP
HLKPALGMNGAKARSHSFSTHSGDKPSTPPIEGSGKVRTQIITNTAERGNSLTRQNSSTE
SSPNKAPSAPMLESLPSVGRPSGHPSSGKGSLGSSGSFSSQHGSPSKLPLRIPPKSEGLL
IPPGKEDQQAFTQGECPSANVAVLGEPGSDRRSCPPTPTDCPEALQSPGRTQHPSTFETS
STSKLETSGRHPDASATATDAVSSEAPLSPTIEEKVMLCIQENVEKGQVQTKPTSVEAKQ
KPGPSFASWFGFRKSRLPALSSRKMDISKTKVEKKDAKVLGFGNRQLKSERKKEKKKPEL
QCETENELIKDTKSADNPDGGLQSKNNRRTPQDIYNQLKIEPRNRHSPVACSTKDTFMTE
LLNRVDKKAAPQTESGSSNASCRNVLKGSSQGSCLIGSSISTQGNHKKNMKIKADMEVPK
DSLVKEANENLQEDEDDAVADSVFQSHIIESNCQMRTLDSGIGTFPLPDSGNRSTGRYLC
QPDSPEDAEPLLPLQSALSAVSSMRAQTLEREVPSSTDGQRPADSAIVHSTSDPIMTARG
MRPLQSRLPKPASSGKVSSQKQNEAEPRPQTCSSFGYAEDPMASQPLPDWGSEVAATGTQ
DKAPRMCTYSASGGSNSDSDLDYGDNGFGAGRGQLVKALKSAAPEIETT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCH0	0.068	0.088	1.428E-12	1334	0.191	0.273	Q9HCH0.pdb.gz	NCK5L_HUMAN Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=4
2	AFDB:P86839	0.074	0.100	1.672E-9	1265	0.102	0.154	P86839.pdb.gz	NEST_DANRE Nestin OS=Danio rerio OX=7955 GN=nes PE=2 SV=1
3	AFDB:Q9Y2F5	0.048	0.041	4.823E-6	2266	0.140	0.118	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
4	AFDB:Q5EE04	0.048	0.046	5.762E-5	1997	0.091	0.087	Q5EE04.pdb.gz	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
5	AFDB:Q6P5H2	0.068	0.069	6.696E-5	1864	0.150	0.154	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
6	AFDB:Q8R4U7	0.065	0.100	6.696E-5	1068	0.084	0.151	Q8R4U7.pdb.gz	LUZP1_MOUSE Leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Luzp1 PE=1 SV=2
7	AFDB:P12036	0.063	0.102	9.751E-5	1026	0.081	0.151	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
8	AFDB:B1AV60	0.031	0.034	5.922E-4	1647	0.135	0.156	B1AV60.pdb.gz	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
9	AFDB:Q6XZL8	0.041	0.047	5.922E-4	1540	0.105	0.131	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
10	AFDB:O15061	0.060	0.071	6.384E-4	1565	0.140	0.171	O15061.pdb.gz	SYNEM_HUMAN Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=3
11	PDB:4v60A	0.034	0.071	4.900E-1	812	0.022	0.052	4v60A.pdb.gz
12	PDB:3javA	0.019	0.016	4.672	2327	0.101	0.083	3javA.pdb.gz
13	PDB:7r5jV0	0.024	0.148	7.334	273	0.023	0.158	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:8escS	0.026	0.130	7.334	268	0.006	0.045	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
15	PDB:7qooK	0.034	0.188	8.524	253	0.013	0.099	7qooK.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
16	PDB:7emfK	0.026	0.309	9.189	112	0.009	0.161	7emfK.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
17	PDB:7rro7	0.018	0.152	9.189	121	0.008	0.124	7rro7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCH0	8.37e-30	132	1334	0.033	0.047	NCK5L_HUMAN Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=4
2	A1Z951	6.27e-07	57.0	639	0.018	0.055	A1Z951_DROME MIP12871p OS=Drosophila melanogaster OX=7227 GN=CG12488 PE=2 SV=2
3	F0JAQ8	8.53e-07	56.6	662	0.018	0.053	F0JAQ8_DROME MIP12971p OS=Drosophila melanogaster OX=7227 GN=CG42663-RB PE=2 SV=1
4	A0A0B4KFS6	8.82e-07	56.6	661	0.018	0.053	A0A0B4KFS6_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG12488 PE=4 SV=1
5	Q99LJ0	0.074	40.4	638	0.033	0.099	CT2NL_MOUSE CTTNBP2 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cttnbp2nl PE=1 SV=1
6	Q0VF96	0.17	39.3	1302	0.035	0.051	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
7	Q9P2B4	0.33	38.1	639	0.031	0.092	CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2
8	Q60779	0.54	37.4	478	0.027	0.107	DRC4_MOUSE Dynein regulatory complex subunit 4 OS=Mus musculus OX=10090 GN=Gas8 PE=1 SV=2
9	Q7XJ96	2.6	35.0	471	0.031	0.125	DRC4_CHLRE Dynein regulatory complex subunit 4 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC4 PE=1 SV=1
10	H0YAY0	2.9	35.0	562	0.021	0.073	H0YAY0_HUMAN Transforming acidic coiled-coil containing protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=1
11	Q8BML1	3.1	35.4	1951	0.025	0.025	MICA2_MOUSE [F-actin]-monooxygenase MICAL2 OS=Mus musculus OX=10090 GN=Mical2 PE=1 SV=2
12	Q803M1	4.2	33.9	248	0.025	0.194	Q803M1_DANRE Tropomyosin 3 OS=Danio rerio OX=7955 GN=cb674 PE=1 SV=1
13	A0A2R8Q650	4.8	33.9	284	0.025	0.169	A0A2R8Q650_DANRE Tropomyosin 3 OS=Danio rerio OX=7955 GN=cb674 PE=1 SV=1
14	G3I183	5.0	34.7	957	0.038	0.076	G3I183_CRIGR Oral-facial-digital syndrome 1 protein-like OS=Cricetulus griseus OX=10029 GN=I79_017133 PE=1 SV=1
15	F4IUG9	7.2	33.9	1493	0.027	0.034	MYO13_ARATH Myosin-13 OS=Arabidopsis thaliana OX=3702 GN=XI-G PE=3 SV=1
16	F1N7G5	9.7	33.5	514	0.028	0.103	CFA53_BOVIN Cilia- and flagella-associated protein 53 OS=Bos taurus OX=9913 GN=CFAP53 PE=1 SV=3
17	Q8NEH6	9.7	33.5	495	0.025	0.095	MNS1_HUMAN Meiosis-specific nuclear structural protein 1 OS=Homo sapiens OX=9606 GN=MNS1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15246 NCKAP5	1.4e-132	453.6	Nck-associated protein 5, Peripheral clock protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387128

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282249	0.723	Guanylate cyclase soluble subunit alpha-2
2	9606.ENSP00000417273	0.648	Cytoplasmic protein NCK1
3	9606.ENSP00000233712	0.645	Protein eva-1 homolog A
4	9606.ENSP00000353249	0.633	Cytosolic carboxypeptidase-like protein 5
5	9606.ENSP00000322775	0.578	Inactive rhomboid protein 2
6	9606.ENSP00000376570	0.570	Polypeptide N-acetylgalactosaminyltransferase 13
7	9606.ENSP00000436786	0.563	Histone-lysine N-methyltransferase 2A
8	9606.ENSP00000384517	0.554	Aryl hydrocarbon receptor nuclear translocator-like protein 1
9	9606.ENSP00000250056	0.550	Protein PIMREG
10	9606.ENSP00000376293	0.535	Oxysterol-binding protein-related protein 6
11	9606.ENSP00000341658	0.534	Dual specificity protein phosphatase 15
12	9606.ENSP00000345001	0.524	CREB-regulated transcription coactivator 1
13	9606.ENSP00000479243	0.512	Endothelial cell-specific chemotaxis regulator
14	9606.ENSP00000342008	0.506	Olfactory receptor 2T27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.980	biological regulation
GO:0050789	0.973	regulation of biological process
GO:0009987	0.954	cellular process
GO:0050794	0.952	regulation of cellular process
GO:0048518	0.369	positive regulation of biological process
GO:0048522	0.309	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0005737	0.961	cytoplasm
GO:0016020	0.948	membrane
GO:0005886	0.943	plasma membrane
GO:0012505	0.938	endomembrane system
GO:0005634	0.891	nucleus
GO:0005856	0.844	cytoskeleton
GO:0005829	0.535	cytosol
GO:0015630	0.524	microtubule cytoskeleton
GO:0031981	0.480	nuclear lumen
GO:0005654	0.362	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]