StarFunc result for job id O14514

User Input

>input (1584 residues)
MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAV
FPANASRCSWTLRNPDPRRYTLYMKVAKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESF
DEVLRLCDPSAPLAFLQASKQFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRN
PSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGEAGGPAAGPLAPRGDVCLRDAV
AGGPENCLTSLTQDRGGHGATGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGVEGGGCE
GVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEW
SPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSL
CSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACS
ASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGA
GSQRRERVCSGPFFGGAACQGPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVA
AVRCPRNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGLPGE
GVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDVQNFVQILSNLL
AEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLVLSIHKLPASG
ATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLTEADEASVFVVGTVLYRNLGSFLA
LQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMYNGTTNQTCILWDETDVPSSSAPPQ
LGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADANMEKATLPSVTLIVGCGVSSL
TLLMLVIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHF
FFLSSFCWVLTEAWQSYMAVTGHLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGYSTM
NYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSC
VVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVV
DRQEEGNGDSGGSFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPE
EEKLKLAHAKGPPTNFNSLPANVSKLHLHGSPRYPGGPLPDFPNHSLTLKRDKAPKSSFV
GDGDIFKKLDSELSRAQEKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHL
STAPEASLPARSPPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLG
DPGEPAAHPGPSTGPSTKNENVATLSVSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLN
RKLQHAAEKDKEVLGPDSKPEKQQTPNKRPWESLRKAHGTPTWVKKELEPLQPSPLELRS
VEWERSGATIPLVGQDIIDLQTEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14514	0.999	0.999	0.000	1584	1.000	1.000	O14514.pdb.gz	AGRB1_HUMAN Adhesion G protein-coupled receptor B1 OS=Homo sapiens OX=9606 GN=ADGRB1 PE=1 SV=2
2	AFDB:O60241	0.240	0.240	0.000	1585	0.424	0.424	O60241.pdb.gz	AGRB2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=2
3	AFDB:O95490	0.219	0.236	3.288E-42	1459	0.142	0.154	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
4	AFDB:Q9Z173	0.215	0.219	6.901E-42	1550	0.145	0.148	Q9Z173.pdb.gz	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
5	AFDB:O88923	0.212	0.223	1.448E-41	1487	0.141	0.151	O88923.pdb.gz	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
6	AFDB:Q9HAR2	0.208	0.225	2.302E-41	1447	0.147	0.161	Q9HAR2.pdb.gz	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
7	AFDB:O94910	0.233	0.249	8.425E-41	1474	0.164	0.176	O94910.pdb.gz	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
8	AFDB:A0A2R8QM07	0.214	0.220	3.083E-40	1540	0.133	0.137	A0A2R8QM07.pdb.gz	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
9	AFDB:O88917	0.214	0.223	3.764E-39	1515	0.137	0.143	O88917.pdb.gz	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
10	AFDB:G5ECX0	0.182	0.211	3.749E-36	1338	0.116	0.137	G5ECX0.pdb.gz	LPLT2_CAEEL Latrophilin-like protein LAT-2 OS=Caenorhabditis elegans OX=6239 GN=lat-2 PE=2 SV=1
11	PDB:1w0rA	0.053	0.148	2.131E-15	442	0.068	0.242	1w0rA.pdb.gz
12	PDB:4k5yC	0.138	0.783	2.966E-8	248	0.039	0.246	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
13	PDB:7tynR	0.133	0.492	5.172E-8	373	0.040	0.172	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
14	PDB:6vn7R	0.138	0.713	1.137E-7	263	0.035	0.213	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
15	PDB:7d3sR	0.135	0.692	3.621E-7	266	0.033	0.199	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
16	PDB:7lciR	0.134	0.476	5.494E-7	393	0.034	0.137	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
17	PDB:7vqxR	0.137	0.527	6.028E-7	361	0.041	0.180	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
18	PDB:7durR	0.137	0.523	6.613E-7	371	0.038	0.162	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
19	PDB:6wpwR	0.137	0.484	1.325E-6	398	0.032	0.128	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
20	PDB:7finR	0.138	0.511	2.781E-6	380	0.039	0.161	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A3C1	0.0	936	1466	0.355	0.383	A2A3C1_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
2	A2A3C2	0.0	1045	1554	0.381	0.388	A2A3C2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
3	A2A3C3	0.0	952	1499	0.351	0.371	A2A3C3_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
4	A2A3C6	0.0	963	1500	0.352	0.371	A2A3C6_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
5	C0HL12	0.0	2938	1577	0.939	0.943	AGRB1_RAT Adhesion G protein-coupled receptor B1 OS=Rattus norvegicus OX=10116 GN=Adgrb1 PE=1 SV=1
6	O14514	0.0	3249	1584	1.000	1.000	AGRB1_HUMAN Adhesion G protein-coupled receptor B1 OS=Homo sapiens OX=9606 GN=ADGRB1 PE=1 SV=2
7	O60241	0.0	1040	1585	0.381	0.381	AGRB2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=2
8	O60242	0.0	1432	1522	0.476	0.495	AGRB3_HUMAN Adhesion G protein-coupled receptor B3 OS=Homo sapiens OX=9606 GN=ADGRB3 PE=1 SV=2
9	Q3UHD1	0.0	2898	1582	0.941	0.942	AGRB1_MOUSE Adhesion G protein-coupled receptor B1 OS=Mus musculus OX=10090 GN=Adgrb1 PE=1 SV=1
10	Q80ZF8	0.0	1424	1522	0.477	0.496	AGRB3_MOUSE Adhesion G protein-coupled receptor B3 OS=Mus musculus OX=10090 GN=Adgrb3 PE=1 SV=2
11	Q8CGM1	0.0	1043	1561	0.382	0.388	AGRB2_MOUSE Adhesion G protein-coupled receptor B2 OS=Mus musculus OX=10090 GN=Adgrb2 PE=1 SV=2
12	D3YXG0	9.53e-60	231	5634	0.085	0.024	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
13	Q96RW7	2.17e-59	229	5635	0.080	0.023	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
14	Q9NYQ6	1.31e-57	223	3014	0.121	0.063	CELR1_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=1
15	A0A6I8PRU0	1.32e-57	223	3019	0.120	0.063	A0A6I8PRU0_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=2
16	F1R9W4	1.29e-53	210	3044	0.107	0.056	F1R9W4_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 OS=Danio rerio OX=7955 GN=celsr1a PE=1 SV=3
17	Q9Z173	1.31e-50	199	1550	0.102	0.105	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
18	Q9HAR2	1.95e-50	199	1447	0.104	0.113	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
19	O35161	3.89e-50	199	3034	0.124	0.065	CELR1_MOUSE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3
20	Q80TS3	6.99e-50	197	1537	0.102	0.105	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	6.1e-59	210.8	7 transmembrane receptor (Secretin family)
2	PF19188 AGRB_N	1.5e-71	251.7	Adhesion GPCR B N-terminal region
3	PF16489 GAIN	1.4e-38	144.0	GPCR-Autoproteolysis INducing (GAIN) domain
4	PF01825 GPS	7e-09	47.5	GPCR proteolysis site, GPS, motif
5	PF02793 HRM	0.00014	33.4	Hormone receptor domain
6	PF19030 TSP1_ADAMTS	3.3e-10	51.4	Thrombospondin type 1 domain
7	PF19035 TSP1_CCN	0.00021	32.9	CCN3 Nov like TSP1 domain
8	PF19028 TSP1_spondin	8.8e-33	123.7	Spondin-like TSP1 domain
9	PF00090 TSP_1	1.1e-44	161.6	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430945

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312185	0.986	Engulfment and cell motility protein 1
2	9606.ENSP00000316338	0.937	Brain-specific angiogenesis inhibitor 1-associated protein 2
3	9606.ENSP00000290246	0.929	Engulfment and cell motility protein 2
4	9606.ENSP00000280333	0.924	Dedicator of cytokinesis protein 1
5	9606.ENSP00000324510	0.885	BAI1 associated protein 3
6	9606.ENSP00000382428	0.846	Disks large homolog 4
7	9606.ENSP00000286827	0.814	T-lymphoma invasion and metastasis-inducing protein 1
8	9606.ENSP00000373539	0.793	Stabilin-2
9	9606.ENSP00000274532	0.775	T-cell immunoglobulin and mucin domain-containing protein 4
10	9606.ENSP00000362680	0.731	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000385450	0.699	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
12	9606.ENSP00000331831	0.691	Growth arrest-specific protein 6
13	9606.ENSP00000268150	0.690	Lactadherin
14	9606.ENSP00000451828	0.683	RAC-alpha serine/threonine-protein kinase
15	9606.ENSP00000380746	0.672	F-box/LRR-repeat protein 16
16	9606.ENSP00000295408	0.613	Tyrosine-protein kinase Mer
17	9606.ENSP00000386289	0.601	PTB domain-containing engulfment adapter protein 1
18	9606.ENSP00000415491	0.597	Phytanoyl-CoA hydroxylase-interacting protein
19	9606.ENSP00000304604	0.595	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
20	9606.ENSP00000320318	0.580	Sialidase-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	0.995	transmembrane signaling receptor activity
GO:0004930	0.975	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.991	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.982	response to stimulus
GO:0016043	0.972	cellular component organization
GO:0048518	0.957	positive regulation of biological process
GO:0006909	0.946	phagocytosis
GO:0051239	0.905	regulation of multicellular organismal process
GO:0048856	0.902	anatomical structure development
GO:0048522	0.891	positive regulation of cellular process
GO:0006897	0.885	endocytosis
GO:0061024	0.875	membrane organization
GO:0032501	0.872	multicellular organismal process
GO:0050793	0.865	regulation of developmental process
GO:0051716	0.846	cellular response to stimulus
GO:0043277	0.836	apoptotic cell clearance
GO:0048519	0.830	negative regulation of biological process
GO:0007165	0.826	signal transduction
GO:0010324	0.804	membrane invagination
GO:0006911	0.788	phagocytosis, engulfment
GO:0007275	0.755	multicellular organism development
GO:0006996	0.735	organelle organization
GO:0051094	0.713	positive regulation of developmental process
GO:0019222	0.668	regulation of metabolic process
GO:0043652	0.637	engulfment of apoptotic cell
GO:0048731	0.634	system development
GO:0022603	0.610	regulation of anatomical structure morphogenesis
GO:2000026	0.559	regulation of multicellular organismal development
GO:0034330	0.506	cell junction organization
GO:0048523	0.483	negative regulation of cellular process
GO:0051128	0.416	regulation of cellular component organization
GO:0060255	0.412	regulation of macromolecule metabolic process
GO:0050808	0.408	synapse organization
GO:0010646	0.394	regulation of cell communication
GO:0023051	0.377	regulation of signaling
GO:0048583	0.348	regulation of response to stimulus
GO:0009893	0.331	positive regulation of metabolic process
GO:0065008	0.326	regulation of biological quality
GO:0031323	0.321	regulation of cellular metabolic process
GO:0044087	0.308	regulation of cellular component biogenesis
GO:0050803	0.307	regulation of synapse structure or activity
GO:0048869	0.307	cellular developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030054	0.993	cell junction
GO:0043226	0.830	organelle
GO:0005737	0.821	cytoplasm
GO:0070161	0.707	anchoring junction
GO:0043227	0.624	membrane-bounded organelle
GO:0043229	0.555	intracellular organelle
GO:0005576	0.520	extracellular region
GO:0005829	0.492	cytosol
GO:0043231	0.445	intracellular membrane-bounded organelle
GO:0045202	0.363	synapse
GO:0048471	0.348	perinuclear region of cytoplasm
GO:0005911	0.310	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]