StarFunc result for job id O14521

User Input

>input (159 residues)
MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSK
AASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL
QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14521	1.000	1.000	3.931E-24	159	1.000	1.000	O14521.pdb.gz	DHSD_HUMAN Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHD PE=1 SV=1
2	AFDB:A5GZW8	0.862	0.862	3.853E-21	159	0.881	0.881	A5GZW8.pdb.gz	DHSD_PIG Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Sus scrofa OX=9823 GN=SDHD PE=1 SV=2
3	AFDB:Q95123	0.727	0.730	1.168E-20	158	0.855	0.861	Q95123.pdb.gz	DHSD_BOVIN Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Bos taurus OX=9913 GN=SDHD PE=2 SV=2
4	AFDB:Q9CXV1	0.786	0.786	7.561E-20	159	0.824	0.824	Q9CXV1.pdb.gz	DHSD_MOUSE Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdhd PE=1 SV=2
5	PDB:4ytpD	0.633	0.986	2.152E-13	102	0.604	0.941	4ytpD.pdb.gz	Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
6	AFDB:Q9P7X0	0.612	0.612	6.045E-7	159	0.245	0.245	Q9P7X0.pdb.gz	DHSD_SCHPO Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdh4 PE=2 SV=2
7	AFDB:A0A1D8PD61	0.600	0.566	2.254E-5	169	0.239	0.225	A0A1D8PD61.pdb.gz	A0A1D8PD61_CANAL Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C103940WA PE=3 SV=1
8	AFDB:P37298	0.580	0.514	3.596E-5	181	0.182	0.160	P37298.pdb.gz	DHSD_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDH4 PE=1 SV=1
9	AFDB:Q06236	0.585	0.556	1.225E-4	168	0.208	0.196	Q06236.pdb.gz	SHH4_YEAST Mitochondrial inner membrane protein SHH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHH4 PE=1 SV=1
10	PDB:6lo8D	0.523	0.683	1.101E-3	119	0.157	0.210	6lo8D.pdb.gz
11	AFDB:Q942X4	0.351	0.279	3.524E-2	211	0.201	0.152	Q942X4.pdb.gz	SDH4_ORYSJ Succinate dehydrogenase subunit 4, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SDH4 PE=1 SV=1
12	AFDB:Q9D3R9	0.227	0.087	1.068E-1	471	0.119	0.040	Q9D3R9.pdb.gz	TAF7L_MOUSE Transcription initiation factor TFIID subunit 7-like OS=Mus musculus OX=10090 GN=Taf7l PE=1 SV=2
13	PDB:2aczC	0.355	0.420	1.319E-1	129	0.107	0.132	2aczC.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
14	PDB:2aczD	0.319	0.426	2.658E-1	113	0.107	0.150	2aczD.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
15	PDB:6eznB	0.387	0.515	8.541E-1	110	0.075	0.109	6eznB.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
16	PDB:2gs4A	0.368	0.368	1.212	159	0.082	0.082	2gs4A.pdb.gz
17	PDB:6jp5E	0.256	0.243	1.444	169	0.094	0.089	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
18	PDB:7f73A	0.186	0.115	1.623	293	0.101	0.055	7f73A.pdb.gz
19	PDB:2b76D	0.254	0.306	2.304	119	0.119	0.160	2b76D.pdb.gz	Fumarate Reductase and Succinate Oxidase Activity of Escherichia coli Complex II Homologs Are Perturbed Differently by Mutation of the Flavin Binding Domain
20	PDB:3tuiA	0.271	0.210	2.304	216	0.119	0.088	3tuiA.pdb.gz	Inward facing conformations of the MetNI methionine ABC transporter: Implications for the mechanism of transinhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14521	1.40e-112	318	159	1.000	1.000	DHSD_HUMAN Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHD PE=1 SV=1
2	Q95123	1.64e-97	280	158	0.855	0.861	DHSD_BOVIN Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Bos taurus OX=9913 GN=SDHD PE=2 SV=2
3	Q9CXV1	8.17e-92	265	159	0.824	0.824	DHSD_MOUSE Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdhd PE=1 SV=2
4	A5GZW8	4.19e-91	263	159	0.881	0.881	DHSD_PIG Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Sus scrofa OX=9823 GN=SDHD PE=1 SV=2
5	Q9P7X0	1.00e-07	50.8	159	0.201	0.201	DHSD_SCHPO Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdh4 PE=2 SV=2
6	A0A1D8PD61	3.00e-06	47.0	169	0.252	0.237	A0A1D8PD61_CANAL Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C103940WA PE=3 SV=1
7	Q8R5K4	2.8	30.4	1152	0.151	0.021	NOL6_MOUSE Nucleolar protein 6 OS=Mus musculus OX=10090 GN=Nol6 PE=2 SV=2
8	P76242	3.0	30.4	393	0.208	0.084	NIMT_ECOLI 2-nitroimidazole transporter OS=Escherichia coli (strain K12) OX=83333 GN=nimT PE=1 SV=1
9	Q384K3	3.5	30.4	4152	0.119	0.005	Q384K3_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0390 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05328 CybS	4.3e-20	83.2	CybS, succinate dehydrogenase cytochrome B small subunit
2	PF02615 Ldh_2	4.8e+02	11.3	Malate/L-lactate dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364699

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264932	0.999	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
2	9606.ENSP00000356953	0.999	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
3	9606.ENSP00000364649	0.999	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
4	9606.ENSP00000355518	0.992	Fumarate hydratase, mitochondrial
5	9606.ENSP00000377446	0.979	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
6	9606.ENSP00000367923	0.961	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
7	9606.ENSP00000419325	0.949	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
8	9606.ENSP00000301761	0.936	Succinate dehydrogenase assembly factor 2, mitochondrial
9	9606.ENSP00000458770	0.933	Acyl carrier protein, mitochondrial
10	9606.ENSP00000417142	0.930	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
11	9606.ENSP00000306397	0.928	Cytochrome b-c1 complex subunit Rieske, mitochondrial
12	9606.ENSP00000369176	0.924	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
13	9606.ENSP00000276689	0.922	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
14	9606.ENSP00000320236	0.921	Mitochondrial import inner membrane translocase subunit Tim22
15	9606.ENSP00000362873	0.919	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
16	9606.ENSP00000259037	0.914	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
17	9606.ENSP00000263774	0.912	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
18	9606.ENSP00000268668	0.912	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
19	9606.ENSP00000246957	0.910	Heat shock protein 75 kDa, mitochondrial
20	9606.ENSP00000296684	0.888	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0009055	0.999	electron transfer activity
GO:0016627	0.992	oxidoreductase activity, acting on the CH-CH group of donors
GO:0097159	0.963	organic cyclic compound binding
GO:1901363	0.962	heterocyclic compound binding
GO:0048038	0.942	quinone binding
GO:0020037	0.937	heme binding
GO:0000104	0.870	succinate dehydrogenase activity
GO:0016635	0.852	oxidoreductase activity, acting on the CH-CH group of donors, quinone or related compound as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0006091	0.976	generation of precursor metabolites and energy
GO:0045333	0.973	cellular respiration
GO:0009060	0.962	aerobic respiration
GO:0044238	0.944	primary metabolic process
GO:0065007	0.423	biological regulation
GO:0050789	0.404	regulation of biological process
GO:0006099	0.357	tricarboxylic acid cycle
GO:0050794	0.319	regulation of cellular process
GO:0050896	0.314	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990204	1.000	oxidoreductase complex
GO:0098803	1.000	respiratory chain complex
GO:0005743	0.999	mitochondrial inner membrane
GO:0098798	0.991	mitochondrial protein-containing complex
GO:0005746	0.988	mitochondrial respirasome
GO:0098800	0.984	inner mitochondrial membrane protein complex
GO:0045273	0.976	respiratory chain complex II
GO:0045257	0.954	succinate dehydrogenase complex (ubiquinone)
GO:0005749	0.903	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)
GO:0070013	0.541	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	1.000	Oxidoreductases.
EC:1.3.-.-	0.992	Acting on the CH-CH group of donors.
RHEA:16357	0.870	A + succinate = AH2 + fumarate
EC:1.3.5.-	0.852	With a quinone or related compound as acceptor.

[back to server]