StarFunc result for job id O14522

User Input

>input (1441 residues)
MASLAALALSLLLRLQLPPLPGARAQSAAGGCSFDEHYSNCGYSVALGTNGFTWEQINTW
EKPMLDQAVPTGSFMMVNSSGRASGQKAHLLLPTLKENDTHCIDFHYYFSSRDRSSPGAL
NVYVKVNGGPQGNPVWNVSGVVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYIAVD
EVRVLAHPCRKAPHFLRLQNVEVNVGQNATFQCIAGGKWSQHDKLWLQQWNGRDTALMVT
RVVNHRRFSATVSVADTAQRSVSKYRCVIRSDGGSGVSNYAELIVKEPPTPIAPPELLAV
GATYLWIKPNANSIIGDGPIILKEVEYRTTTGTWAETHIVDSPNYKLWHLDPDVEYEIRV
LLTRPGEGGTGPPGPPLTTRTKCADPVHGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSY
NLTVQYQYVFNQQQYEAEEVIQTSSHYTLRGLRPFMTIRLRLLLSNPEGRMESEELVVQT
EEDVPGAVPLESIQGGPFEEKIYIQWKPPNETNGVITLYEINYKAVGSLDPSADLSSQRG
KVFKLRNETHHLFVGLYPGTTYSFTIKASTAKGFGPPVTTRIATKISAPSMPEYDTDTPL
NETDTTITVMLKPAQSRGAPVSVYQLVVKEERLQKSRRAADIIECFSVPVSYRNASSLDS
LHYFAAELKPANLPVTQPFTVGDNKTYNGYWNPPLSPLKSYSIYFQALSKANGETKINCV
RLATKGASTQNSNTVEPEKQVDNTVKMAGVIAGLLMFIIILLGVMLTIKRRRNAYSYSYY
LKLAKKQKETQSGAQREMGPVASADKPTTKLSASRNDEGFSSSSQDVNGFTDGSRGELSQ
PTLTIQTHPYRTCDPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQ
TASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIAT
QGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEP
LAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPI
VVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAI
LEACLCGNTAIPVCEFRSLYYNISRLDPQTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLP
RNHDKNRSMDVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFVVTQHPLPNTVADF
WRLVFDYNCSSVVMLNEMDTAQFCMQYWPEKTSGCYGPIQVEFVSADIDEDIIHRIFRIC
NMARPQDGYRIVQHLQYIGWPAYRDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLN
GGGRSGTFCAICSVCEMIQQQNIIDVFHIVKTLRNNKSNMVETLEQYKFVYEVALEYLSS
F

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AUH1	0.491	0.489	0.000	1446	0.513	0.511	B1AUH1.pdb.gz	PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus OX=10090 GN=Ptpru PE=1 SV=1
2	AFDB:B3DK56	0.473	0.472	0.000	1444	0.516	0.515	B3DK56.pdb.gz	PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio OX=7955 GN=ptpru PE=2 SV=1
3	AFDB:F1LXJ9	0.409	0.464	0.000	1269	0.872	0.991	F1LXJ9.pdb.gz	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
4	AFDB:P28827	0.496	0.493	0.000	1452	0.656	0.651	P28827.pdb.gz	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
5	AFDB:P35822	0.495	0.490	0.000	1457	0.572	0.566	P35822.pdb.gz	PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus OX=10090 GN=Ptprk PE=1 SV=1
6	AFDB:F1NWE3	0.397	0.378	1.741E-97	1516	0.287	0.272	F1NWE3.pdb.gz	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
7	AFDB:A0A0H2UKT5	0.393	0.297	2.306E-95	1914	0.271	0.204	A0A0H2UKT5.pdb.gz
8	AFDB:A4IFW2	0.394	0.299	1.364E-93	1909	0.262	0.197	A4IFW2.pdb.gz	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
9	AFDB:P23468	0.389	0.294	1.941E-93	1912	0.271	0.204	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
10	AFDB:B0V2N1	0.390	0.295	2.409E-92	1907	0.264	0.200	B0V2N1.pdb.gz	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
11	PDB:4gwfA	0.184	0.522	5.594E-26	497	0.083	0.239	4gwfA.pdb.gz
12	PDB:3ps5A	0.183	0.490	4.640E-25	529	0.084	0.229	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:5xzrA	0.181	0.493	4.880E-25	519	0.083	0.229	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
14	PDB:6krwA	0.177	0.783	4.746E-20	306	0.061	0.288	6krwA.pdb.gz
15	PDB:3m4uA	0.156	0.737	2.789E-15	285	0.054	0.274	3m4uA.pdb.gz
16	PDB:7q1yA	0.077	0.080	3.693E-13	1374	0.051	0.054	7q1yA.pdb.gz
17	PDB:7q5zA	0.081	0.085	5.255E-13	1344	0.060	0.064	7q5zA.pdb.gz
18	PDB:5oj2B	0.106	0.188	7.863E-13	692	0.058	0.121	5oj2B.pdb.gz
19	PDB:8eyyA	0.151	0.256	1.177E-12	775	0.042	0.077	8eyyA.pdb.gz
20	PDB:6pyhD	0.145	0.242	4.145E-12	798	0.049	0.088	6pyhD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3H0	0.0	1516	1430	0.513	0.517	A0A0G2K3H0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpru PE=3 SV=2
2	A0A8I5ZW41	0.0	2963	1465	0.988	0.971	A0A8I5ZW41_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
3	A0A8I6AFL3	0.0	2934	1455	0.981	0.971	A0A8I6AFL3_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
4	A5HV10	0.0	926	709	0.311	0.632	A5HV10_RAT Receptor-like protein tyrosine phosphatase kappa (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
5	A5I9F0	0.0	1742	1439	0.576	0.577	A5I9F0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
6	B1AUH1	0.0	1571	1446	0.525	0.523	PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus OX=10090 GN=Ptpru PE=1 SV=1
7	B3DK56	0.0	1487	1444	0.529	0.528	PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio OX=7955 GN=ptpru PE=2 SV=1
8	E7EPS8	0.0	1934	1390	0.639	0.663	E7EPS8_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
9	E9PGC5	0.0	1766	1472	0.589	0.577	E9PGC5_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1
10	F1LXJ9	0.0	2935	1454	0.981	0.972	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
11	F1MAG7	0.0	1511	1380	0.508	0.530	F1MAG7_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpru PE=3 SV=2
12	O14522	0.0	3016	1441	1.000	1.000	PTPRT_HUMAN Receptor-type tyrosine-protein phosphatase T OS=Homo sapiens OX=9606 GN=PTPRT PE=1 SV=6
13	P28827	0.0	1976	1452	0.654	0.649	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
14	P28828	0.0	1966	1452	0.654	0.649	PTPRM_MOUSE Receptor-type tyrosine-protein phosphatase mu OS=Mus musculus OX=10090 GN=Ptprm PE=1 SV=2
15	P35822	0.0	1737	1457	0.576	0.570	PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus OX=10090 GN=Ptprk PE=1 SV=1
16	Q15262	0.0	1745	1439	0.577	0.577	PTPRK_HUMAN Receptor-type tyrosine-protein phosphatase kappa OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=2
17	Q5TG12	0.0	1739	1458	0.577	0.570	Q5TG12_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1
18	Q92729	0.0	1566	1446	0.526	0.524	PTPRU_HUMAN Receptor-type tyrosine-protein phosphatase U OS=Homo sapiens OX=9606 GN=PTPRU PE=1 SV=2
19	Q99M80	0.0	2933	1454	0.980	0.971	PTPRT_MOUSE Receptor-type tyrosine-protein phosphatase T OS=Mus musculus OX=10090 GN=Ptprt PE=1 SV=2
20	Q9WUL3	6.28e-174	530	502	0.171	0.492	Q9WUL3_RAT Receptor-like protein tyrosine phosphatase kappa extracellular region OS=Rattus norvegicus OX=10116 GN=RPTPK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	0.00013	33.2	Dual specificity phosphatase, catalytic domain
2	PF00041 fn3	1.3e-24	97.7	Fibronectin type III domain
3	PF07679 I-set	86	14.6	Immunoglobulin I-set domain
4	PF00047 ig	3.9e+02	12.6	Immunoglobulin domain
5	PF00629 MAM	1.3e-25	101.6	MAM domain, meprin/A5/mu
6	PF14566 PTPlike_phytase	0.26	22.8	Inositol hexakisphosphate
7	PF18861 PTP_tm	1.5e+02	14.1	TM proximal of protein tyrosine phosphatase, receptor type J
8	PF00102 Y_phosphatase	1.1e-145	494.9	Protein-tyrosine phosphatase
9	PF13350 Y_phosphatase3	0.17	23.4	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362294

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261769	0.837	Cadherin-1
2	9606.ENSP00000264657	0.723	Signal transducer and activator of transcription 3
3	9606.ENSP00000427567	0.678	Microtubule-associated formin which regulates both actin and microtubule dynamics. Induces microtubule acetylation and stabilization and actin stress fiber formation . Regulates Golgi ribbon formation . Required for normal cilia assembly. Early in cilia assembly, may assist in the maturation and positioning of the centrosome/basal body, and once cilia assembly has initiated, may also promote cilia elongation by inhibiting disassembly
4	9606.ENSP00000280362	0.670	6-pyruvoyl tetrahydrobiopterin synthase
5	9606.ENSP00000363667	0.593	Tyrosine-protein phosphatase non-receptor type 3
6	9606.ENSP00000480890	0.589	Sodium- and chloride-dependent taurine transporter
7	9606.ENSP00000437790	0.579	Cadherin-22
8	9606.ENSP00000394794	0.576	Tyrosine-protein phosphatase non-receptor type 13
9	9606.ENSP00000295718	0.546	Receptor-type tyrosine-protein phosphatase-like N
10	9606.ENSP00000304437	0.545	Protein very KIND
11	9606.ENSP00000386213	0.537	Myosin-IIIb
12	9606.ENSP00000295057	0.530	Leucine-rich repeat transmembrane neuronal protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0004725	0.995	protein tyrosine phosphatase activity
GO:0008013	0.988	beta-catenin binding
GO:0005001	0.837	transmembrane receptor protein tyrosine phosphatase activity
GO:0045296	0.780	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0009987	0.981	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0050803	0.761	regulation of synapse structure or activity
GO:0050807	0.749	regulation of synapse organization
GO:0050896	0.493	response to stimulus
GO:0008152	0.490	metabolic process
GO:0071704	0.435	organic substance metabolic process
GO:0044238	0.433	primary metabolic process
GO:0044237	0.433	cellular metabolic process
GO:0006807	0.394	nitrogen compound metabolic process
GO:0043170	0.347	macromolecule metabolic process
GO:0019538	0.336	protein metabolic process
GO:0023052	0.334	signaling
GO:0007154	0.333	cell communication
GO:0051716	0.330	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005886	1.000	plasma membrane
GO:0030054	0.994	cell junction
GO:0045202	0.933	synapse
GO:0098794	0.844	postsynapse
GO:0045211	0.778	postsynaptic membrane
GO:0099572	0.707	postsynaptic specialization
GO:0098984	0.685	neuron to neuron synapse
GO:0005622	0.674	intracellular anatomical structure
GO:0014069	0.666	postsynaptic density
GO:0099634	0.661	postsynaptic specialization membrane
GO:0098839	0.629	postsynaptic density membrane
GO:0005737	0.596	cytoplasm
GO:0043227	0.507	membrane-bounded organelle
GO:0043229	0.494	intracellular organelle
GO:0098978	0.447	glutamatergic synapse
GO:0043231	0.434	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	0.995	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.995	protein-tyrosine-phosphatase.

[back to server]