StarFunc result for job id O14523

User Input

>input (706 residues)
MDPGWGQRDVGWAALLILFAASLLTVFAWLLQYARGLWLARARGDRGPGPALAGEPAGSL
RELGVWRSLLRLRATRAGAAEEPGVRGLLASLFAFKSFRENWQRAWVRALNEQACRNGSS
IQIAFEEVPQLPPRASISHVTCVDQSEHTMVLRCQLSAEEVRFPVSVTQQSPAAVSMETY
HVTLTLPPTQLEVNLEEIPGEGLLISWAFTDRPDLSLTVLPKLQARERGEEQVELSTIEE
LIKDAIVSTQPAMMVNLRACSAPGGLVPSEKPPMMPQAQPAIPRPNRLFLRQLRASHLGN
ELEGTEELCCVAELDNPMQQKWTKPARAGSEVEWTEDLALDLGPQSRELTLKVLRSSSCG
DTELLGQATLPVGSPSRPLSRRQLCPLTPGPGKALGPAATMAVELHYEEGSPRNLGTPTS
STPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRIDGKLDSPSRSPSKVEVTEKTTT
VLSESSGPSNTSHSSSRDSHLSNGLDPVAETAIRQLTEPSGRVAKKTPTKRSTLIISGVS
KVPIAQDELALSLGYAASLEASVQDDAGTSGGPSSPPSDPPAMSPGPLDALSSPTSVQEA
DETTRSDISERPSVDDIESETGSTGALETRSLKDHKVSFLRSGTKLIFRRRPRQKEAGLS
QSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14523	1.000	1.000	0.000	706	1.000	1.000	O14523.pdb.gz	C2C2L_HUMAN Phospholipid transfer protein C2CD2L OS=Homo sapiens OX=9606 GN=C2CD2L PE=1 SV=3
2	AFDB:Q9BXF6	0.162	0.174	1.643E-7	653	0.112	0.121	Q9BXF6.pdb.gz	RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
3	PDB:3nsjA	0.144	0.190	8.980E-7	530	0.064	0.085	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
4	AFDB:Q52KB6	0.144	0.047	1.280E-6	2323	0.127	0.039	Q52KB6.pdb.gz	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
5	AFDB:Q8N3D4	0.148	0.071	2.537E-6	1523	0.096	0.045	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
6	PDB:5a50A	0.148	0.562	4.591E-6	165	0.035	0.152	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
7	AFDB:Q99NE5	0.113	0.062	9.971E-6	1463	0.136	0.066	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
8	AFDB:Q9JIS1	0.114	0.060	1.051E-5	1555	0.135	0.061	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
9	AFDB:Q9VID5	0.141	0.099	1.367E-5	1039	0.098	0.066	Q9VID5.pdb.gz	Q9VID5_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8671 PE=3 SV=2
10	PDB:4rj9A	0.145	0.564	3.054E-5	161	0.028	0.124	4rj9A.pdb.gz
11	PDB:1bp1A	0.087	0.113	3.219E-5	456	0.052	0.081	1bp1A.pdb.gz
12	PDB:6kxkD	0.132	0.165	3.219E-5	553	0.055	0.071	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
13	PDB:1cjyA	0.153	0.170	3.770E-5	633	0.033	0.036	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:4m4dA	0.108	0.147	5.744E-5	448	0.054	0.085	4m4dA.pdb.gz
15	PDB:5a52A	0.141	0.560	7.090E-5	154	0.027	0.123	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	AFDB:Q92859	0.080	0.043	9.587E-5	1461	0.129	0.062	Q92859.pdb.gz	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
17	PDB:7lq1A	0.143	0.110	1.333E-4	950	0.079	0.059	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
18	AFDB:P97603	0.087	0.048	1.461E-4	1377	0.112	0.057	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
19	PDB:5izrC	0.145	0.155	2.257E-4	659	0.030	0.032	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
20	AFDB:Q4ZHG4	0.086	0.037	2.346E-4	1894	0.130	0.049	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PK05	0.0	807	415	0.579	0.986	E9PK05_HUMAN C2CD2 like (Fragment) OS=Homo sapiens OX=9606 GN=C2CD2L PE=1 SV=2
2	O14523	0.0	1414	706	1.000	1.000	C2C2L_HUMAN Phospholipid transfer protein C2CD2L OS=Homo sapiens OX=9606 GN=C2CD2L PE=1 SV=3
3	Q80X80	0.0	1239	706	0.909	0.909	C2C2L_MOUSE Phospholipid transfer protein C2CD2L OS=Mus musculus OX=10090 GN=C2cd2l PE=1 SV=3
4	Q9Y426	1.37e-69	243	696	0.337	0.342	C2CD2_HUMAN C2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=C2CD2 PE=1 SV=2
5	X2JEA7	0.19	37.4	420	0.038	0.064	X2JEA7_DROME Rab11 interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
6	X2JL40	0.23	37.4	826	0.038	0.033	X2JL40_DROME Rab11 interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
7	Q494I2	0.25	37.0	409	0.038	0.066	Q494I2_DROME GH05001p OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
8	Q9VWS3	0.25	37.0	832	0.038	0.032	Q9VWS3_DROME Rab11 interacting protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
9	X2JFP6	0.29	37.0	815	0.038	0.033	X2JFP6_DROME Rab11 interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
10	Q0JBH9	0.52	34.3	144	0.030	0.146	ERG3_ORYSJ Elicitor-responsive protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=ERG3 PE=1 SV=1
11	A2VCZ7	1.5	34.7	866	0.033	0.027	A2VCZ7_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=id:ibd1121 PE=1 SV=1
12	F6P346	1.5	34.7	867	0.033	0.027	F6P346_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=id:ibd1121 PE=1 SV=1
13	Q86JM8	1.6	33.9	254	0.041	0.114	Q86JM8_DICDI C2 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=egeA PE=4 SV=1
14	F4J5Y7	2.0	33.9	400	0.030	0.052	F4J5Y7_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g58690 PE=1 SV=1
15	C8V1M3	3.1	33.5	459	0.025	0.039	C8V1M3_EMENI Septin B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06688 PE=3 SV=1
16	P26231	3.5	33.5	906	0.027	0.021	CTNA1_MOUSE Catenin alpha-1 OS=Mus musculus OX=10090 GN=Ctnna1 PE=1 SV=1
17	E5RIB1	7.3	31.6	215	0.027	0.088	E5RIB1_HUMAN Catenin alpha 1 (Fragment) OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1
18	G3XAM7	8.2	32.3	841	0.027	0.023	G3XAM7_HUMAN Catenin (Cadherin-associated protein), alpha 1, 102kDa, isoform CRA_a OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1
19	Q7Z1P8	8.7	32.0	809	0.025	0.022	Q7Z1P8_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tmem-24 PE=1 SV=1
20	Q7Z1P9	9.0	32.0	811	0.025	0.022	Q7Z1P9_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tmem-24 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	3.1	19.5	C2 domain
2	PF18696 SMP_C2CD2L	7.5e-49	177.0	Synaptotagmin-like, mitochondrial and lipid-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338885

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251527	0.737	Extended synaptotagmin-2
2	9606.ENSP00000334642	0.731	PDZ domain-containing protein 8
3	9606.ENSP00000364919	0.729	GTP-binding protein Di-Ras2
4	9606.ENSP00000322218	0.695	Membrane-associated phosphatidylinositol transfer protein 2
5	9606.ENSP00000456226	0.685	Interferon induced transmembrane protein domain containing
6	9606.ENSP00000254624	0.673	Protein EFR3 homolog A
7	9606.ENSP00000464006	0.668	Cytoplasmic phosphatidylinositol transfer protein 1
8	9606.ENSP00000267113	0.642	Extended synaptotagmin-1
9	9606.ENSP00000416040	0.615	Belongs to the UPF0606 family
10	9606.ENSP00000348772	0.601	Membrane-associated phosphatidylinositol transfer protein 1
11	9606.ENSP00000423366	0.583	Involved in epithelial cell integrity by acting on the maintenance of the actin cytoskeleton. Positively regulates the actin polymerization, by inhibiting the interaction of actin-capping proteins with actin
12	9606.ENSP00000332287	0.574	Synaptogyrin-1
13	9606.ENSP00000374218	0.559	Extended synaptotagmin-3
14	9606.ENSP00000335247	0.557	START domain-containing protein 10
15	9606.ENSP00000164133	0.548	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
16	9606.ENSP00000338164	0.547	Transmembrane protein 217
17	9606.ENSP00000320246	0.543	Sodium/hydrogen exchanger 9
18	9606.ENSP00000359729	0.543	Sodium/hydrogen exchanger 6
19	9606.ENSP00000324318	0.514	Trafficking protein particle complex subunit 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035091	0.998	phosphatidylinositol binding
GO:0008526	0.995	phosphatidylinositol transfer activity
GO:0033218	0.319	amide binding
GO:0042562	0.316	hormone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.987	regulation of cellular process
GO:0032879	0.800	regulation of localization
GO:0048522	0.797	positive regulation of cellular process
GO:0051049	0.761	regulation of transport
GO:0035774	0.751	positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0009987	0.434	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.974	endomembrane system
GO:0005737	0.972	cytoplasm
GO:0043227	0.971	membrane-bounded organelle
GO:0043229	0.965	intracellular organelle
GO:0071944	0.962	cell periphery
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0005886	0.949	plasma membrane
GO:0098827	0.651	endoplasmic reticulum subcompartment
GO:0044232	0.635	organelle membrane contact site
GO:0098590	0.546	plasma membrane region
GO:0098552	0.536	side of membrane
GO:0009898	0.520	cytoplasmic side of plasma membrane
GO:0140268	0.384	endoplasmic reticulum-plasma membrane contact site
GO:0005938	0.361	cell cortex
GO:0045177	0.318	apical part of cell
GO:0016324	0.314	apical plasma membrane
GO:0071782	0.308	endoplasmic reticulum tubular network
GO:0032541	0.304	cortical endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]