StarFunc result for job id O14525

User Input

>input (1302 residues)
MALAGLCALLACCWGPAAVLATAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPS
ASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLF
HIHHQDGAPSLPGQDPTEEPQHESAEEELRILHISVMGGMIALLLSILCLVMILYTRRRW
CKRRRVPQPQKSASAEAANEIHYIPSVLIGGHGRESLRNARVQGHNSSGTLSIRETPILD
GYEYDITDLRHHLQRECMNGGEDFASQVTRTLDSLQGCNEKSGMDLTPGSDNAKLSLMNK
YKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSGTEAENDPQLT
FYTDPSRSRRRSRVGSPRSPVNKTTLTLISITSCVIGLVCSSHVNCPLVVKITLHVPEHL
IADGSRFILLEGSQLDASDWLNPAQVVLFSQQNSSGPWAMDLCARRLLDPCEHQCDPETG
RREHRAAGECLCYEGYMKDPVHKHLCIRNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIF
RFTYTLGEGMWLPLSKSFVIPPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLE
VLLDSFGPVRDCSKDNGGCSKNFRCISDRKLDSTGCVCPSGLSPMKDSSGCYDRHIGVDC
SDGFNGGCEQLCLQQMAPFPDDPTLYNILMFCGCIEDYKLGVDGRSCQLITETCPEGSDC
GESRELPMNQTLFGEMFFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQLPDGLVVATVP
LENQCLEEISEPTPDPDFLTGMVNFSEVSGYPVLQHWKVRSVMYHIKLNQVAISQALSNA
LHSLDGATSRADFVALLDQFGNHYIQEAIYGFEESCSIWYPNKQVQRRLWLEYEDISKGN
SPSDESEERERDPKVLTFPEYITSLSDSGTKHMAAGVRMECHSKGRCPSSCPLCHVTSSP
DTPAEPVLLEVTKAAPIYELVTNNQTQRLLQEATMSSLWCSGTGDVIEDWCRCDSTAFGA
DGLPTCAPLPQPVLRLSTVHEPSSTLVVLEWEHSEPPIGVQIVDYLLRQEKVTDRMDHSK
VETETVLSFVDDIISGAKSPCAMPSQVPDKQLTTISLIIRCLEPDTIYMFTLWGVDNTGR
RSRPSDVIVKTPCPVVDDVKAQEIADKIYNLFNGYTSGKEQQTAYNTLLDLGSPTLHRVL
YHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKISLRRSSLKYLG
CRYSEIKPYGLDWAELSRDLRKTCEEQTLSIPYNDYGDSKEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14525	1.000	1.000	0.000	1302	1.000	1.000	O14525.pdb.gz	ASTN1_HUMAN Astrotactin-1 OS=Homo sapiens OX=9606 GN=ASTN1 PE=1 SV=3
2	PDB:3nsjA	0.145	0.319	2.589E-10	530	0.052	0.128	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
3	PDB:4e0sB	0.168	0.228	1.924E-9	898	0.051	0.075	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
4	PDB:3t5oA	0.160	0.223	3.688E-9	871	0.058	0.087	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
5	PDB:6u2lA	0.146	0.279	3.688E-9	613	0.047	0.100	6u2lA.pdb.gz
6	PDB:3ojyB	0.150	0.353	1.063E-7	504	0.045	0.115	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
7	PDB:7nydE	0.115	0.279	2.038E-7	484	0.041	0.112	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
8	PDB:6u23A	0.134	0.278	4.123E-7	583	0.039	0.087	6u23A.pdb.gz
9	PDB:7nycD	0.125	0.303	6.361E-7	487	0.051	0.136	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
10	PDB:4a5wB	0.147	0.208	1.036E-6	871	0.048	0.072	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
11	PDB:6sb3A	0.145	0.280	1.287E-6	604	0.050	0.108	6sb3A.pdb.gz
12	AFDB:Q86TC9	0.060	0.059	5.829E-5	1320	0.095	0.094	Q86TC9.pdb.gz	MYPN_HUMAN Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2
13	AFDB:B7YZW3	0.071	0.047	7.450E-4	2064	0.110	0.069	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
14	AFDB:Q59IW9	0.075	0.089	1.551E-2	1079	0.108	0.130	Q59IW9.pdb.gz	Q59IW9_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
15	AFDB:Q9VHC4	0.054	0.060	2.816E-2	1133	0.102	0.117	Q9VHC4.pdb.gz	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
16	AFDB:Q6AWD5	0.055	0.057	3.692E-2	1220	0.108	0.115	Q6AWD5.pdb.gz	Q6AWD5_DROME AT02057p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8176 PE=1 SV=1
17	AFDB:Q4ZHG4	0.071	0.049	4.842E-2	1894	0.116	0.080	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
18	AFDB:C0H520	0.068	0.056	6.014E-2	1797	0.092	0.067	C0H520.pdb.gz	C0H520_PLAF7 Exoribonuclease II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0906000 PE=4 SV=1
19	AFDB:O35158	0.027	0.028	6.703E-2	1256	0.035	0.037	O35158.pdb.gz	CDON_RAT Cell adhesion molecule-related/down-regulated by oncogenes OS=Rattus norvegicus OX=10116 GN=Cdon PE=1 SV=2
20	AFDB:A0A0R4IDE1	0.061	0.085	1.432E-1	872	0.088	0.131	A0A0R4IDE1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y3A8	0.0	1081	1062	0.417	0.511	H0Y3A8_HUMAN Astrotactin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ASTN2 PE=1 SV=1
2	O14525	0.0	2703	1302	1.000	1.000	ASTN1_HUMAN Astrotactin-1 OS=Homo sapiens OX=9606 GN=ASTN1 PE=1 SV=3
3	O75129	0.0	1285	1339	0.502	0.488	ASTN2_HUMAN Astrotactin-2 OS=Homo sapiens OX=9606 GN=ASTN2 PE=1 SV=2
4	Q61137	0.0	2663	1302	0.979	0.979	ASTN1_MOUSE Astrotactin-1 OS=Mus musculus OX=10090 GN=Astn1 PE=1 SV=4
5	Q80Z10	0.0	1283	1352	0.498	0.480	ASTN2_MOUSE Astrotactin-2 OS=Mus musculus OX=10090 GN=Astn2 PE=1 SV=2
6	Q8MQJ4	6.62e-05	49.7	832	0.029	0.046	Q8MQJ4_DROME LD32019p (Fragment) OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=1
7	Q9VS89	2.35e-04	48.1	1618	0.029	0.023	Q9VS89_DROME FI18763p1 OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=4
8	M9PHP7	0.004	44.3	1427	0.025	0.023	M9PHP7_DROME Faulty attraction, isoform F OS=Drosophila melanogaster OX=7227 GN=frac PE=4 SV=1
9	Q5G872	0.008	43.1	1010	0.027	0.035	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
10	Q14393	0.009	42.7	678	0.021	0.040	GAS6_HUMAN Growth arrest-specific protein 6 OS=Homo sapiens OX=9606 GN=GAS6 PE=1 SV=3
11	Q9NQ36	0.011	42.7	999	0.035	0.045	SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCUBE2 PE=1 SV=3
12	Q9JJS0	0.032	41.2	997	0.025	0.032	SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus OX=10090 GN=Scube2 PE=1 SV=1
13	Q9NZR2	0.039	41.2	4599	0.025	0.007	LRP1B_HUMAN Low-density lipoprotein receptor-related protein 1B OS=Homo sapiens OX=9606 GN=LRP1B PE=1 SV=2
14	Q8IWY4	0.040	40.8	988	0.026	0.034	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
15	Q6NZL8	0.12	39.3	1018	0.026	0.033	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
16	Q61592	0.18	38.5	674	0.026	0.050	GAS6_MOUSE Growth arrest-specific protein 6 OS=Mus musculus OX=10090 GN=Gas6 PE=2 SV=2
17	F1R0I7	0.19	38.5	995	0.023	0.030	F1R0I7_DANRE Scube3 OS=Danio rerio OX=7955 GN=scube3 PE=2 SV=3
18	P07204	0.24	38.1	575	0.025	0.056	TRBM_HUMAN Thrombomodulin OS=Homo sapiens OX=9606 GN=THBD PE=1 SV=2
19	Q9JI18	0.25	38.5	4599	0.024	0.007	LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B OS=Mus musculus OX=10090 GN=Lrp1b PE=1 SV=1
20	Q66PY1	0.34	37.7	993	0.025	0.033	SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18411 Annexin_like	2.4e-46	167.3	Annexin-like domain
2	PF19743 ASTN1_2_EGF_Fn	1.6e-57	206.2	ASTN1/2 EGF-like and Fn(III) domains
3	PF19441 ASTN_1_2_N	0	1215.0	Astrotactin 1/2 N-terminal
4	PF18577 ASTN_2_hairpin	8.8	17.8	Astrotactin-2 C-terminal beta-hairpin domain
5	PF14670 FXa_inhibition	2.7e-07	42.1	Coagulation Factor Xa inhibitory site
6	PF01823 MACPF	52	15.4	MAC/Perforin domain
7	PF09064 Tme5_EGF_like	21	16.4	Thrombomodulin like fifth domain, EGF-like
8	PF10577 UPF0560	2.4e+02	11.7	Uncharacterised protein family UPF0560

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000030561

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000010089	0.835	Uncharacterized protein
2	9544.ENSMMUP00000019879	0.828	Adaptor-related protein complex 4, epsilon 1 subunit
3	9544.ENSMMUP00000016643	0.804	Myosin X
4	9544.ENSMMUP00000006707	0.731	Cyclin dependent kinase like 5
5	9544.ENSMMUP00000028524	0.675	Actin filament associated protein 1-like 1
6	9544.ENSMMUP00000033888	0.670	Uncharacterized protein
7	9544.ENSMMUP00000028526	0.634	GrpE protein homolog
8	9544.ENSMMUP00000029425	0.622	MAP kinase-activated protein kinase 5 isoform 1
9	9544.ENSMMUP00000022352	0.610	PILR-associating neural protein
10	9544.ENSMMUP00000027341	0.593	Sigma non-opioid intracellular receptor 1 isoform 1
11	9544.ENSMMUP00000022625	0.551	Leucine rich repeat and Ig domain containing 2
12	9544.ENSMMUP00000030206	0.540	BMP/retinoic acid inducible neural specific 2
13	9544.ENSMMUP00000024746	0.539	Contactin-2
14	9544.ENSMMUP00000035467	0.528	Gem (nuclear organelle) associated protein 4
15	9544.ENSMMUP00000025435	0.526	Solute carrier family 35 member G2
16	9544.ENSMMUP00000014038	0.504	Synaptotagmin X

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0007275	0.981	multicellular organism development
GO:0007399	0.969	nervous system development
GO:0050789	0.812	regulation of biological process
GO:0050794	0.777	regulation of cellular process
GO:0048870	0.599	cell motility
GO:0001764	0.535	neuron migration
GO:0007155	0.435	cell adhesion
GO:0007610	0.413	behavior
GO:0007626	0.384	locomotory behavior
GO:0098609	0.303	cell-cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	0.999	endosome
GO:0005886	0.998	plasma membrane
GO:0009986	0.470	cell surface
GO:0098552	0.324	side of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]