StarFunc result for job id O14526

User Input

>input (889 residues)
MSYFGEHFWGEKNHGFEVLYHSVKQGPISTKELADFIRERATIEETYSKAMAKLSKLASN
GTPMGTFAPLWEVFRVSSDKLALCHLELTRKLQDLIKDVLRYGEEQLKTHKKCKEEVVST
LDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRESTSQKEMDKAETKTKKAAESLRRSVE
KYNSARADFEQKMLDSALRFQAMEETHLRHMKALLGSYAHSVEDTHVQIGQVHEEFKQNI
ENVSVEMLLRKFAESKGTGREKPGPLDFEAYSAAALQEAMKRLRGAKAFRLPGLSRRERE
PEPPAAVDFLEPDSGTCPEVDEEGFTVRPDVTQNSTAEPSRFSSSDSDFDDEEPRKFYVH
IKPAPARAPACSPEAAAAQLRATAGSLILPPGPGGTMKRHSSRDAAGKPQRPRSAPRTSS
CAERLQSEEQVSKNLFGPPLESAFDHEDFTGSSSLGFTSSPSPFSSSSPENVEDSGLDSP
SHAAPGPSPDSWVPRPGTPQSPPSCRAPPPEARGIRAPPLPDSPQPLASSPGPWGLEALA
GGDLMPAPADPTAREGLAAPPRRLRSRKVSCPLTRSNGDLSRSLSPSPLGSSAASTALER
PSFLSQTGHGVSRGPSPVVLGSQDALPIATAFTEYVHAYFRGHSPSCLARVTGELTMTFP
AGIVRVFSGTPPPPVLSFRLVHTTAIEHFQPNADLLFSDPSQSDPETKDFWLNMAALTEA
LQRQAEQNPTASYYNVVLLRYQFSRPGPQSVPLQLSAHWQCGATLTQVSVEYGYRPGATA
VPTPLTNVQILLPVGEPVTNVRLQPAATWNLEEKRLTWRLPDVSEAGGSGRLSASWEPLS
GPSTPSPVAAQFTSEGTTLSGVDLELVGSGYRMSLVKRRFATGMYLVSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0QZI3	0.393	0.390	0.000	896	0.989	0.981	M0QZI3.pdb.gz
2	AFDB:Q8K285	0.352	0.358	0.000	873	0.862	0.877	Q8K285.pdb.gz	FCHO1_MOUSE F-BAR domain only protein 1 OS=Mus musculus OX=10090 GN=Fcho1 PE=1 SV=2
3	AFDB:E7FBF7	0.344	0.341	2.482E-87	897	0.525	0.521	E7FBF7.pdb.gz	FCHO1_DANRE F-BAR domain only protein 1 OS=Danio rerio OX=7955 GN=fcho1 PE=1 SV=2
4	AFDB:Q0JRZ9	0.332	0.362	1.089E-82	810	0.451	0.495	Q0JRZ9.pdb.gz	FCHO2_HUMAN F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2 PE=1 SV=2
5	AFDB:Q502I9	0.319	0.333	2.606E-81	848	0.444	0.466	Q502I9.pdb.gz	FCHO2_DANRE F-BAR domain only protein 2 OS=Danio rerio OX=7955 GN=fcho2 PE=2 SV=1
6	AFDB:Q9VHC4	0.311	0.245	2.716E-63	1133	0.336	0.264	Q9VHC4.pdb.gz	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
7	AFDB:A0A0B4KFZ2	0.307	0.238	1.103E-61	1161	0.352	0.270	A0A0B4KFZ2.pdb.gz	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
8	AFDB:Q6AWD5	0.311	0.230	7.032E-61	1220	0.355	0.259	Q6AWD5.pdb.gz	Q6AWD5_DROME AT02057p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8176 PE=1 SV=1
9	AFDB:Q9TXS0	0.285	0.262	5.355E-49	968	0.236	0.217	Q9TXS0.pdb.gz	Q9TXS0_CAEEL FCH domain only protein 2 OS=Caenorhabditis elegans OX=6239 GN=fcho-1 PE=1 SV=1
10	AFDB:Q10199	0.262	0.334	3.253E-15	670	0.150	0.199	Q10199.pdb.gz	IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp2 PE=1 SV=1
11	PDB:5nzuD	0.201	0.392	6.083E-14	427	0.047	0.098	5nzuD.pdb.gz
12	PDB:1w63M	0.212	0.448	2.896E-12	388	0.049	0.113	1w63M.pdb.gz
13	PDB:6cm9M	0.221	0.447	4.422E-12	415	0.047	0.101	6cm9M.pdb.gz	HIV-1 Nefs Are Cargo-Sensitive AP-1 Trimerization Switches in Tetherin Downregulation.
14	PDB:7rwaM	0.216	0.477	1.344E-11	379	0.044	0.103	7rwaM.pdb.gz	Structural basis of an endocytic checkpoint that primes the AP2 clathrin adaptor for cargo internalization.
15	PDB:5a1wH	0.204	0.429	1.494E-11	380	0.044	0.103	5a1wH.pdb.gz
16	PDB:6ikoA	0.251	0.650	2.673E-11	303	0.076	0.224	6ikoA.pdb.gz
17	PDB:2jkrM	0.225	0.454	9.519E-11	409	0.051	0.110	2jkrM.pdb.gz	A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
18	PDB:3hajA	0.247	0.677	4.298E-9	286	0.055	0.171	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
19	PDB:3fcsA	0.084	0.082	1.938E-5	913	0.035	0.034	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
20	PDB:7nxdA	0.075	0.073	3.038E-4	905	0.033	0.032	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C3SFZ9	0.0	1793	891	0.992	0.990	A0A0C3SFZ9_HUMAN FCH and mu domain containing endocytic adaptor 1 OS=Homo sapiens OX=9606 GN=FCHO1 PE=1 SV=1
2	E7FBF7	0.0	890	897	0.525	0.521	FCHO1_DANRE F-BAR domain only protein 1 OS=Danio rerio OX=7955 GN=fcho1 PE=1 SV=2
3	O14526	0.0	1812	889	1.000	1.000	FCHO1_HUMAN F-BAR domain only protein 1 OS=Homo sapiens OX=9606 GN=FCHO1 PE=1 SV=2
4	Q8K285	0.0	1434	873	0.863	0.879	FCHO1_MOUSE F-BAR domain only protein 1 OS=Mus musculus OX=10090 GN=Fcho1 PE=1 SV=2
5	Q0JRZ9	2.83e-132	417	810	0.235	0.258	FCHO2_HUMAN F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2 PE=1 SV=2
6	Q3UQN2	1.19e-131	416	809	0.244	0.268	FCHO2_MOUSE F-BAR domain only protein 2 OS=Mus musculus OX=10090 GN=Fcho2 PE=1 SV=1
7	D3ZYR1	2.01e-129	410	809	0.241	0.265	FCHO2_RAT F-BAR domain only protein 2 OS=Rattus norvegicus OX=10116 GN=Fcho2 PE=1 SV=1
8	Q502I9	1.09e-126	404	848	0.228	0.239	FCHO2_DANRE F-BAR domain only protein 2 OS=Danio rerio OX=7955 GN=fcho2 PE=2 SV=1
9	Q8VD37	2.41e-87	298	806	0.156	0.172	SGIP1_MOUSE SH3-containing GRB2-like protein 3-interacting protein 1 OS=Mus musculus OX=10090 GN=Sgip1 PE=1 SV=1
10	Q9BQI5	7.58e-87	297	828	0.156	0.168	SGIP1_HUMAN SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1 PE=1 SV=2
11	Q6IZA3	1.82e-86	296	827	0.155	0.167	SGIP1_PSAOB SH3-containing GRB2-like protein 3-interacting protein 1 OS=Psammomys obesus OX=48139 GN=SGIP1 PE=1 SV=1
12	A0A0B4KFZ2	2.87e-78	278	1161	0.229	0.176	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
13	Q9VHC4	4.41e-78	277	1133	0.229	0.180	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
14	Q6AWD5	6.22e-78	278	1220	0.229	0.167	Q6AWD5_DROME AT02057p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8176 PE=1 SV=1
15	Q8T035	6.78e-77	271	924	0.232	0.223	Q8T035_DROME LD34536p OS=Drosophila melanogaster OX=7227 GN=CG8165 PE=2 SV=1
16	Q9TXS0	3.99e-42	169	968	0.099	0.091	Q9TXS0_CAEEL FCH domain only protein 2 OS=Caenorhabditis elegans OX=6239 GN=fcho-1 PE=1 SV=1
17	Q10199	1.86e-19	95.9	670	0.083	0.110	IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp2 PE=1 SV=1
18	P97814	3.08e-19	93.6	415	0.080	0.171	PPIP1_MOUSE Proline-serine-threonine phosphatase-interacting protein 1 OS=Mus musculus OX=10090 GN=Pstpip1 PE=1 SV=1
19	A0A0S2Z5P3	7.37e-17	86.3	416	0.073	0.156	A0A0S2Z5P3_HUMAN Proline-serine-threonine phosphatase interacting protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSTPIP1 PE=2 SV=1
20	O43586	7.37e-17	86.3	416	0.073	0.156	PPIP1_HUMAN Proline-serine-threonine phosphatase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PSTPIP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00611 FCH	2.2e-10	52.1	Fes/CIP4, and EFC/F-BAR homology domain
2	PF10291 muHD	5.1e-50	182.0	Muniscin C-terminal mu homology domain
3	PF16722 SAPIS-gp6	1.3e+02	14.4	Pathogenicity island protein gp6 in Staphylococcus
4	PF12220 U1snRNP70_N	1.7	20.6	U1 small nuclear ribonucleoprotein of 70kDa MW N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000018230

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000001250	0.876	Epidermal growth factor receptor pathway substrate 15
2	9598.ENSPTRP00000053973	0.875	Intersectin 1 (SH3 domain protein)
3	9598.ENSPTRP00000018168	0.854	Uncharacterized protein
4	9598.ENSPTRP00000040453	0.808	AP-2 complex subunit alpha
5	9598.ENSPTRP00000020124	0.798	Uncharacterized protein
6	9598.ENSPTRP00000020635	0.784	Uncharacterized protein
7	9598.ENSPTRP00000039324	0.779	Clathrin heavy chain
8	9598.ENSPTRP00000035797	0.778	Clathrin light chain
9	9598.ENSPTRP00000019816	0.775	Uncharacterized protein
10	9598.ENSPTRP00000019213	0.770	Adaptor-related protein complex 2, sigma 1 subunit
11	9598.ENSPTRP00000038902	0.757	NECAP endocytosis associated 1
12	9598.ENSPTRP00000017652	0.748	Uncharacterized protein
13	9598.ENSPTRP00000000409	0.739	NECAP endocytosis associated 2
14	9598.ENSPTRP00000005552	0.730	AP-2 complex subunit alpha
15	9598.ENSPTRP00000015128	0.721	Uncharacterized protein
16	9598.ENSPTRP00000031840	0.711	Uncharacterized protein
17	9598.ENSPTRP00000039993	0.707	Uncharacterized protein
18	9598.ENSPTRP00000028835	0.702	Dab, mitogen-responsive phosphoprotein, homolog 2 (Drosophila)
19	9598.ENSPTRP00000042696	0.698	Sorting nexin
20	9598.ENSPTRP00000026981	0.695	Adaptor-related protein complex 2, mu 1 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.359	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0023052	0.995	signaling
GO:0007154	0.995	cell communication
GO:0016043	0.990	cellular component organization
GO:0006897	0.989	endocytosis
GO:0007165	0.975	signal transduction
GO:0048522	0.959	positive regulation of cellular process
GO:0048584	0.955	positive regulation of response to stimulus
GO:0006898	0.951	receptor-mediated endocytosis
GO:0051239	0.937	regulation of multicellular organismal process
GO:0002429	0.917	immune response-activating cell surface receptor signaling pathway
GO:0002694	0.878	regulation of leukocyte activation
GO:0072583	0.873	clathrin-dependent endocytosis
GO:0030155	0.838	regulation of cell adhesion
GO:1903039	0.828	positive regulation of leukocyte cell-cell adhesion
GO:0002696	0.827	positive regulation of leukocyte activation
GO:0051251	0.822	positive regulation of lymphocyte activation
GO:0050852	0.802	T cell receptor signaling pathway
GO:0050870	0.796	positive regulation of T cell activation
GO:0022607	0.693	cellular component assembly
GO:0043933	0.627	protein-containing complex organization
GO:0065003	0.352	protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0031981	0.999	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0016020	0.923	membrane
GO:0005886	0.874	plasma membrane
GO:0012505	0.866	endomembrane system
GO:0098590	0.444	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]