StarFunc result for job id O14529

User Input

>input (1486 residues)
MAANVGSMFQYWKRFDLRRLQKELNSVASELSARQEESEHSHKHLIELRREFKKNVPEEI
REMVAPVLKSFQAEVVALSKRSQEAEAAFLSVYKQLIEAPDPVPVFEAARSLDDRLQPPS
FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQR
NEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAELLELRRKYDEEAASKADEVG
LIMTNLEKANQRAEAAQREVESLREQLASVNSSIRLACCSPQGPSGDKVNFTLCSGPRLE
AALASKDREILRLLKDVQHLQSSLQELEEASANQIADLERQLTAKSEAIEKLEEKLQAQS
DYEEIKTELSILKAMKLASSTCSLPQGMAKPEDSLLIAKEAFFPTQKFLLEKPSLLASPE
EDPSEDDSIKDSLGTEQSYPSPQQLPPPPGPEDPLSPSPGQPLLGPSLGPDGTRTFSLSP
FPSLASGERLMMPPAAFKGEAGGLLVFPPAFYGAKPPTAPATPAPGPEPLGGPEPADGGG
GGAAGPGAEEEQLDTAEIAFQVKEQLLKHNIGQRVFGHYVLGLSQGSVSEILARPKPWRK
LTVKGKEPFIKMKQFLSDEQNVLALRTIQVRQRGSITPRIRTPETGSDDAIKSILEQAKK
EIESQKGGEPKTSVAPLSIANGTTPASTSEDAIKSILEQARREMQAQQQALLEMEVAPRG
RSVPPSPPERPSLATASQNGAPALVKQEEGSGGPAQAPLPVLSPAAFVQSIIRKVKSEIG
DAGYFDHHWASDRGLLSRPYASVSPSLSSSSSSGYSGQPNGRAWPRGDEAPVPPEDEAAA
GAEDEPPRTGELKAEGATAEAGARLPYYPAYVPRTLKPTVPPLTPEQYELYMYREVDTLE
LTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLS
DQLGQAVGQQPGASQASPTEPRSSPSPPPSPTEPEKSSQEPLSLSLESSKENQQPEGRSS
SSLSGKMYSGSQAPGGIQEIVAMSPELDTYSITKRVKEVLTDNNLGQRLFGESILGLTQG
SVSDLLSRPKPWHKLSLKGREPFVRMQLWLNDPHNVEKLRDMKKLEKKAYLKRRYGLIST
GSDSESPATRSECPSPCLQPQDLSLLQIKKPRVVLAPEEKEALRKAYQLEPYPSQQTIEL
LSFQLNLKTNTVINWFHNYRSRMRREMLVEGTQDEPDLDPSGGPGILPPGHSHPDPTPQS
PDSETEDQKPTVKELELQEGPEENSTPLTTQDKAQVRIKQEQMEEDAEEEAGSQPQDSGE
LDKGQGPPKEEHPDPPGNDGLPKVAPGPLLPGGSTPDCPSLHPQQESEAGERLHPDPLSF
KSASESSRCSLEVSLNSPSAASSPGLMMSVSPVPSSSAPISPSPPGAPPAKVPSASPTAD
MAGALHPSAKVNPNLQRRHEKMANLNNIIYRVERAANREEALEWEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14529	0.999	0.999	0.000	1486	1.000	1.000	O14529.pdb.gz	CUX2_HUMAN Homeobox protein cut-like 2 OS=Homo sapiens OX=9606 GN=CUX2 PE=1 SV=4
2	AFDB:P53565	0.172	0.171	3.438E-77	1504	0.463	0.457	P53565.pdb.gz	CUX1_RAT Homeobox protein cut-like 1 OS=Rattus norvegicus OX=10116 GN=Cux1 PE=1 SV=2
3	AFDB:P39880	0.136	0.135	2.647E-73	1505	0.456	0.450	P39880.pdb.gz	CUX1_HUMAN Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=3
4	AFDB:P53564	0.153	0.150	7.477E-73	1515	0.456	0.448	P53564.pdb.gz	CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=3
5	AFDB:F1M8A4	0.059	0.070	6.215E-7	1150	0.122	0.157	F1M8A4.pdb.gz	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
6	AFDB:B8QI36	0.070	0.086	9.699E-7	1187	0.132	0.165	B8QI36.pdb.gz	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
7	AFDB:Q69ZW5	0.069	0.078	3.507E-6	1140	0.127	0.166	Q69ZW5.pdb.gz	Q69ZW5_MOUSE MKIAA0897 protein (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=2 SV=1
8	AFDB:M9PC73	0.073	0.090	1.884E-5	1158	0.092	0.118	M9PC73.pdb.gz	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
9	AFDB:A0A024R9F1	0.052	0.075	2.080E-5	873	0.078	0.133	A0A024R9F1.pdb.gz
10	AFDB:Q00083	0.036	0.033	2.798E-5	1676	0.139	0.124	Q00083.pdb.gz	APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=apsA PE=1 SV=2
11	PDB:4egcA	0.051	0.105	2.045E-2	539	0.030	0.082	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:7myoB	0.069	0.298	9.674E-1	286	0.013	0.066	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
13	PDB:8dcxB	0.048	0.209	9.674E-1	236	0.012	0.076	8dcxB.pdb.gz
14	PDB:7fbyA	0.028	0.199	1.239	153	0.009	0.092	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:2hi3A	0.036	0.615	1.510	73	0.007	0.151	2hi3A.pdb.gz
16	PDB:7n6g3I	0.063	0.198	1.840	401	0.039	0.145	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
17	PDB:7sqcO1	0.056	0.108	2.031	673	0.038	0.085	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:6dv9F	0.038	0.221	2.134	174	0.017	0.144	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
19	PDB:6z6oC	0.036	0.093	2.732	548	0.011	0.029	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
20	PDB:3f51A	0.039	0.464	3.016	94	0.009	0.149	3f51A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y852	0.0	965	1460	0.418	0.425	A0A2R8Y852_HUMAN Homeobox protein cut-like OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=1
2	A0A2R8YDI1	0.0	640	1358	0.264	0.289	A0A2R8YDI1_HUMAN Homeobox protein cut-like OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=1
3	O14529	0.0	2972	1486	1.000	1.000	CUX2_HUMAN Homeobox protein cut-like 2 OS=Homo sapiens OX=9606 GN=CUX2 PE=1 SV=4
4	P39880	0.0	965	1505	0.422	0.417	CUX1_HUMAN Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=3
5	P53564	0.0	967	1515	0.422	0.414	CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=3
6	P70298	0.0	2146	1426	0.804	0.838	CUX2_MOUSE Homeobox protein cut-like 2 OS=Mus musculus OX=10090 GN=Cux2 PE=2 SV=2
7	Q13948	9.97e-104	348	678	0.133	0.292	CASP_HUMAN Protein CASP OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=2
8	P70403	1.15e-101	343	678	0.131	0.288	CASP_MOUSE Protein CASP OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=2
9	P10180	2.36e-47	189	2175	0.064	0.044	CUT_DROME Homeobox protein cut OS=Drosophila melanogaster OX=7227 GN=ct PE=1 SV=1
10	Q9LS42	5.72e-22	105	689	0.065	0.139	CASP_ARATH Protein CASP OS=Arabidopsis thaliana OX=3702 GN=CASP PE=1 SV=2
11	O08755	7.59e-14	78.2	465	0.037	0.118	HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus OX=10090 GN=Onecut1 PE=1 SV=1
12	P70512	7.73e-14	78.2	465	0.037	0.118	HNF6_RAT Hepatocyte nuclear factor 6 OS=Rattus norvegicus OX=10116 GN=Onecut1 PE=1 SV=1
13	O60422	8.23e-14	78.2	494	0.042	0.126	ONEC3_HUMAN One cut domain family member 3 OS=Homo sapiens OX=9606 GN=ONECUT3 PE=1 SV=2
14	Q9UBC0	9.62e-14	77.8	465	0.040	0.129	HNF6_HUMAN Hepatocyte nuclear factor 6 OS=Homo sapiens OX=9606 GN=ONECUT1 PE=2 SV=1
15	Q8K557	3.58e-13	76.3	490	0.037	0.112	ONEC3_MOUSE One cut domain family member 3 OS=Mus musculus OX=10090 GN=Onecut3 PE=1 SV=2
16	Q6NYT7	1.47e-12	73.9	456	0.038	0.125	Q6NYT7_DANRE One cut domain family member OS=Danio rerio OX=7955 GN=oc1 PE=2 SV=1
17	Q6PHC9	2.22e-12	73.6	461	0.038	0.124	Q6PHC9_DANRE One cut domain family member OS=Danio rerio OX=7955 GN=oc1 PE=2 SV=1
18	Q22812	3.49e-12	72.4	399	0.046	0.170	HM39_CAEEL Homeobox protein ceh-39 OS=Caenorhabditis elegans OX=6239 GN=ceh-39 PE=1 SV=1
19	O95948	5.07e-11	69.3	504	0.036	0.105	ONEC2_HUMAN One cut domain family member 2 OS=Homo sapiens OX=9606 GN=ONECUT2 PE=2 SV=2
20	Q6XBJ3	5.50e-11	69.3	505	0.036	0.105	ONEC2_MOUSE One cut domain family member 2 OS=Mus musculus OX=10090 GN=Onecut2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12407 Abdominal-A	1.6e+02	13.4	Homeobox protein
2	PF02376 CUT	3.1e-79	272.4	CUT domain
3	PF14362 DUF4407	2.4	19.0	Domain of unknown function (DUF4407)
4	PF15397 DUF4618	17	16.2	Domain of unknown function (DUF4618)
5	PF17733 DUF5572	50	15.2	Family of unknown function (DUF5572)
6	PF02181 FH2	23	15.6	Formin Homology 2 Domain
7	PF04814 HNF-1_N	77	15.1	Hepatocyte nuclear factor 1 (HNF-1), N terminus
8	PF05920 Homeobox_KN	1.7	20.0	Homeobox KN domain
9	PF00046 Homeodomain	8.9e-10	49.6	Homeodomain
10	PF18107 HTH_ABP1_N	4.6	18.3	Fission yeast centromere protein N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261726

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218249	0.794	Ras-related protein Rab-40A-like
2	9606.ENSP00000267512	0.793	Ras-related protein Rab-15
3	9606.ENSP00000328551	0.789	Ras-related protein Rab-28
4	9606.ENSP00000264710	0.788	Ras-related protein Rab-10
5	9606.ENSP00000300935	0.788	Ras-related protein Rab-8A
6	9606.ENSP00000312734	0.788	Ras-related protein Rab-8B
7	9606.ENSP00000331748	0.788	Ras-related protein Rab-12
8	9606.ENSP00000357564	0.788	Ras-related protein Rab-13
9	9606.ENSP00000361716	0.788	Ras-related protein Rab-40A
10	9606.ENSP00000365630	0.788	Ras and EF-hand domain-containing protein
11	9606.ENSP00000409382	0.788	EF-hand calcium-binding domain-containing protein 4B
12	9606.ENSP00000438492	0.788	Ras-related protein Rab-40C
13	9606.ENSP00000461785	0.788	Ras-related protein Rab-40B
14	9606.ENSP00000481054	0.788	Ras-related protein Rab-44
15	9606.ENSP00000283268	0.776	Fez family zinc finger protein 2
16	9606.ENSP00000377668	0.754	Sulfite oxidase, mitochondrial
17	9606.ENSP00000358795	0.748	E3 ubiquitin-protein ligase NEURL1
18	9606.ENSP00000374205	0.689	T-box brain protein 1
19	9606.ENSP00000401112	0.668	DNA-binding protein SATB2
20	9606.ENSP00000353292	0.659	Amiloride-sensitive sodium channel subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140110	0.805	transcription regulator activity
GO:0003700	0.552	DNA-binding transcription factor activity
GO:0000977	0.531	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.350	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0032501	0.972	multicellular organismal process
GO:0051252	0.968	regulation of RNA metabolic process
GO:0031326	0.967	regulation of cellular biosynthetic process
GO:2001141	0.963	regulation of RNA biosynthetic process
GO:0010468	0.960	regulation of gene expression
GO:0031324	0.955	negative regulation of cellular metabolic process
GO:0051172	0.953	negative regulation of nitrogen compound metabolic process
GO:0010558	0.948	negative regulation of macromolecule biosynthetic process
GO:0006355	0.948	regulation of DNA-templated transcription
GO:0045892	0.939	negative regulation of DNA-templated transcription
GO:0006357	0.924	regulation of transcription by RNA polymerase II
GO:0000122	0.897	negative regulation of transcription by RNA polymerase II
GO:0050877	0.875	nervous system process
GO:0050890	0.624	cognition
GO:0009987	0.467	cellular process
GO:0048518	0.320	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.905	cytoplasm
GO:0005576	0.818	extracellular region
GO:0070013	0.795	intracellular organelle lumen
GO:0031981	0.744	nuclear lumen
GO:0065010	0.733	extracellular membrane-bounded organelle
GO:0005615	0.705	extracellular space
GO:0070062	0.696	extracellular exosome
GO:0012505	0.675	endomembrane system
GO:0005654	0.483	nucleoplasm
GO:0005829	0.468	cytosol
GO:0016020	0.383	membrane
GO:0005794	0.353	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]