StarFunc result for job id O14543

User Input

>input (225 residues)
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14543	1.000	1.000	5.061E-44	225	1.000	1.000	O14543.pdb.gz	SOCS3_HUMAN Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1
2	AFDB:L0N8K9	0.766	0.831	6.527E-29	207	0.560	0.609	L0N8K9.pdb.gz
3	AFDB:Q9NSE2	0.648	0.568	9.355E-17	258	0.316	0.275	Q9NSE2.pdb.gz	CISH_HUMAN Cytokine-inducible SH2-containing protein OS=Homo sapiens OX=9606 GN=CISH PE=1 SV=1
4	AFDB:B5XCB4	0.649	0.649	1.404E-15	225	0.284	0.284	B5XCB4.pdb.gz	B5XCB4_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
5	AFDB:Q08BW5	0.646	0.684	2.723E-15	212	0.284	0.302	Q08BW5.pdb.gz	Q08BW5_DANRE Cytokine-inducible SH2-containing protein OS=Danio rerio OX=7955 GN=CISH PE=2 SV=1
6	AFDB:O14508	0.621	0.699	3.262E-15	198	0.280	0.318	O14508.pdb.gz	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
7	AFDB:V9Q4K1	0.607	0.677	4.971E-15	200	0.293	0.330	V9Q4K1.pdb.gz	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
8	AFDB:O35716	0.603	0.637	3.025E-14	212	0.271	0.288	O35716.pdb.gz	SOCS1_MOUSE Suppressor of cytokine signaling 1 OS=Mus musculus OX=10090 GN=Socs1 PE=1 SV=1
9	AFDB:Q6DEF9	0.600	0.666	3.025E-14	201	0.280	0.313	Q6DEF9.pdb.gz	Q6DEF9_DANRE Socs1 protein OS=Danio rerio OX=7955 GN=SOCS1 PE=2 SV=1
10	AFDB:V9Q5U6	0.596	0.594	3.678E-11	226	0.240	0.239	V9Q5U6.pdb.gz	V9Q5U6_SALSA Suppressor of cytokine signaling 1 OS=Salmo salar OX=8030 GN=SOCS1 PE=2 SV=1
11	PDB:4gwfA	0.319	0.150	2.074E-5	497	0.129	0.058	4gwfA.pdb.gz
12	PDB:1ka6A	0.336	0.662	2.638E-5	107	0.089	0.187	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
13	PDB:8dcxB	0.322	0.308	5.769E-5	236	0.124	0.119	8dcxB.pdb.gz
14	PDB:4fl2A	0.312	0.132	6.508E-5	555	0.084	0.034	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:3ps5A	0.318	0.140	9.338E-5	529	0.116	0.049	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
16	PDB:5xzrA	0.312	0.140	1.423E-4	519	0.120	0.052	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
17	PDB:1k9aB	0.303	0.160	2.447E-4	441	0.093	0.048	1k9aB.pdb.gz
18	PDB:4k2rA	0.304	0.132	2.447E-4	551	0.116	0.047	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
19	PDB:7myoB	0.316	0.252	4.206E-4	286	0.124	0.098	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
20	PDB:1griA	0.305	0.324	8.155E-4	211	0.089	0.095	1griA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14543	1.81e-166	459	225	1.000	1.000	SOCS3_HUMAN Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1
2	O35718	9.89e-161	445	225	0.969	0.969	SOCS3_MOUSE Suppressor of cytokine signaling 3 OS=Mus musculus OX=10090 GN=Socs3 PE=1 SV=1
3	O88583	7.72e-158	437	225	0.956	0.956	SOCS3_RAT Suppressor of cytokine signaling 3 OS=Rattus norvegicus OX=10116 GN=Socs3 PE=1 SV=1
4	Q7ZUC6	1.18e-86	257	207	0.569	0.618	Q7ZUC6_DANRE Suppressor of cytokine signaling 3 OS=Danio rerio OX=7955 GN=fj09e12 PE=2 SV=1
5	O14508	2.04e-22	92.4	198	0.262	0.298	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
6	O88582	3.22e-22	92.0	198	0.253	0.288	SOCS2_RAT Suppressor of cytokine signaling 2 OS=Rattus norvegicus OX=10116 GN=Socs2 PE=2 SV=1
7	O35717	7.96e-22	90.9	198	0.258	0.293	SOCS2_MOUSE Suppressor of cytokine signaling 2 OS=Mus musculus OX=10090 GN=Socs2 PE=1 SV=1
8	V9Q4K1	2.46e-21	89.7	200	0.253	0.285	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
9	V9Q6E2	2.79e-21	89.4	200	0.249	0.280	V9Q6E2_SALSA Suppressor of cytokine signaling 2a OS=Salmo salar OX=8030 GN=SOCS2a PE=2 SV=1
10	O70512	2.75e-20	88.2	256	0.293	0.258	CISH_RAT Cytokine-inducible SH2-containing protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Cish PE=2 SV=1
11	Q62225	3.04e-20	88.2	257	0.298	0.261	CISH_MOUSE Cytokine-inducible SH2-containing protein OS=Mus musculus OX=10090 GN=Cish PE=1 SV=1
12	Q6DEF9	4.32e-20	86.3	201	0.213	0.239	Q6DEF9_DANRE Socs1 protein OS=Danio rerio OX=7955 GN=SOCS1 PE=2 SV=1
13	Q9NSE2	1.90e-19	85.9	258	0.289	0.252	CISH_HUMAN Cytokine-inducible SH2-containing protein OS=Homo sapiens OX=9606 GN=CISH PE=1 SV=1
14	O15524	2.30e-19	84.7	211	0.200	0.213	SOCS1_HUMAN Suppressor of cytokine signaling 1 OS=Homo sapiens OX=9606 GN=SOCS1 PE=1 SV=1
15	Q4JHT5	2.30e-19	84.7	211	0.200	0.213	Q4JHT5_HUMAN Suppressor of cytokine signaling 1 OS=Homo sapiens OX=9606 GN=SOCS1 PE=2 SV=1
16	O35716	7.06e-19	83.6	212	0.204	0.217	SOCS1_MOUSE Suppressor of cytokine signaling 1 OS=Mus musculus OX=10090 GN=Socs1 PE=1 SV=1
17	Q9QX78	9.16e-19	83.2	212	0.204	0.217	SOCS1_RAT Suppressor of cytokine signaling 1 OS=Rattus norvegicus OX=10116 GN=Socs1 PE=3 SV=1
18	Q08BW5	6.10e-17	78.2	212	0.276	0.292	Q08BW5_DANRE Cytokine-inducible SH2-containing protein OS=Danio rerio OX=7955 GN=CISH PE=2 SV=1
19	B5XCB4	7.85e-17	78.2	225	0.258	0.258	B5XCB4_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
20	B9EPA9	1.43e-14	72.0	225	0.258	0.258	B9EPA9_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	4.7e-07	41.1	SH2 domain
2	PF07525 SOCS_box	0.14	23.8	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000018556

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000005088	0.998	Janus kinase 2
2	60711.ENSCSAP00000009676	0.988	Transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
3	60711.ENSCSAP00000016666	0.988	Janus kinase 1
4	60711.ENSCSAP00000008380	0.982	Signal transducer and activator of transcription 1, 91kDa
5	60711.ENSCSAP00000016663	0.981	Leptin receptor
6	60711.ENSCSAP00000001784	0.980	Janus kinase 3
7	60711.ENSCSAP00000001478	0.972	Signal transducer and activator of transcription 2, 113kDa
8	60711.ENSCSAP00000014828	0.967	Signal transducer and activator of transcription 3 (acute-phase response factor)
9	60711.ENSCSAP00000015038	0.963	Cullin 5
10	60711.ENSCSAP00000012297	0.959	Interleukin 6 signal transducer
11	60711.ENSCSAP00000015571	0.950	Protein tyrosine phosphatase, non-receptor type 11
12	60711.ENSCSAP00000014906	0.946	Signal transducer and activator of transcription 5A
13	60711.ENSCSAP00000000073	0.944	Suppressor of cytokine signaling 2
14	60711.ENSCSAP00000013502	0.941	Insulin receptor substrate 2
15	60711.ENSCSAP00000006604	0.937	annotation not available
16	60711.ENSCSAP00000017424	0.937	Uncharacterized protein
17	60711.ENSCSAP00000018734	0.937	annotation not available
18	60711.ENSCSAP00000014910	0.936	Signal transducer and activator of transcription 5B
19	60711.ENSCSAP00000003080	0.906	Receptor for erythropoietin
20	60711.ENSCSAP00000010909	0.903	RAS p21 protein activator (GTPase activating protein) 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.813	molecular function regulator activity
GO:0019210	0.777	kinase inhibitor activity
GO:0019887	0.737	protein kinase regulator activity
GO:0004860	0.729	protein kinase inhibitor activity
GO:0005102	0.616	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0048583	0.994	regulation of response to stimulus
GO:0050896	0.992	response to stimulus
GO:0009987	0.988	cellular process
GO:0009966	0.982	regulation of signal transduction
GO:0048585	0.963	negative regulation of response to stimulus
GO:0051716	0.955	cellular response to stimulus
GO:0032502	0.948	developmental process
GO:0042221	0.948	response to chemical
GO:0048523	0.930	negative regulation of cellular process
GO:0007165	0.916	signal transduction
GO:0048856	0.903	anatomical structure development
GO:0019222	0.896	regulation of metabolic process
GO:0048518	0.854	positive regulation of biological process
GO:0060255	0.852	regulation of macromolecule metabolic process
GO:0010033	0.839	response to organic substance
GO:0048522	0.834	positive regulation of cellular process
GO:0009968	0.831	negative regulation of signal transduction
GO:0031323	0.826	regulation of cellular metabolic process
GO:0080090	0.801	regulation of primary metabolic process
GO:0051171	0.800	regulation of nitrogen compound metabolic process
GO:0042325	0.651	regulation of phosphorylation
GO:0051246	0.650	regulation of protein metabolic process
GO:0001932	0.637	regulation of protein phosphorylation
GO:0034097	0.593	response to cytokine
GO:0070887	0.593	cellular response to chemical stimulus
GO:0071310	0.570	cellular response to organic substance
GO:0032501	0.554	multicellular organismal process
GO:0009893	0.509	positive regulation of metabolic process
GO:0007166	0.505	cell surface receptor signaling pathway
GO:0080134	0.487	regulation of response to stress
GO:0006950	0.476	response to stress
GO:0009605	0.468	response to external stimulus
GO:0002376	0.462	immune system process
GO:0009892	0.444	negative regulation of metabolic process
GO:0044419	0.425	biological process involved in interspecies interaction between organisms
GO:0010941	0.420	regulation of cell death
GO:0031325	0.411	positive regulation of cellular metabolic process
GO:0042981	0.410	regulation of apoptotic process
GO:0010468	0.389	regulation of gene expression
GO:0051239	0.382	regulation of multicellular organismal process
GO:0010605	0.374	negative regulation of macromolecule metabolic process
GO:0002682	0.373	regulation of immune system process
GO:0032101	0.351	regulation of response to external stimulus
GO:0010604	0.348	positive regulation of macromolecule metabolic process
GO:0071345	0.341	cellular response to cytokine stimulus
GO:0051172	0.333	negative regulation of nitrogen compound metabolic process
GO:0031324	0.333	negative regulation of cellular metabolic process
GO:0050793	0.332	regulation of developmental process
GO:0009607	0.325	response to biotic stimulus
GO:1904892	0.323	regulation of receptor signaling pathway via STAT
GO:0031347	0.322	regulation of defense response
GO:0008152	0.321	metabolic process
GO:0051707	0.312	response to other organism
GO:0048513	0.311	animal organ development
GO:0019219	0.310	regulation of nucleobase-containing compound metabolic process
GO:0065009	0.306	regulation of molecular function
GO:0046425	0.305	regulation of receptor signaling pathway via JAK-STAT

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.985	membrane-bounded organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005634	0.957	nucleus
GO:0016020	0.350	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]