StarFunc result for job id O14545

User Input

>input (582 residues)
MAEFLDDQETRLCDNCKKEIPVFNFTIHEIHCQRNIGMCPTCKEPFPKSDMETHMAAEHC
QVTCKCNKKLEKRLLKKHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCG
RNVLVKDLKTHPEVCGREGEEKRNEVAIPPNAYDESWGQDGIWIASQLLRQIEALDPPMR
LPRRPLRAFESDVFHNRTTNQRNITAQVSIQNNLFEEQERQERNRGQQPPKEGGEESANL
DFMLALSLQNEGQASSVAEQDFWRAVCEADQSHGGPRSLSDIKGAADEIMLPCEFCEELY
PEELLIDHQTSCNPSRALPSLNTGSSSPRGVEEPDVIFQNFLQQAASNQLDSLMGLSNSH
PVEESIIIPCEFCGVQLEEEVLFHHQDQCDQRPATATNHVTEGIPRLDSQPQETSPELPR
RRVRHQGDLSSGYLDDTKQETANGPTSCLPPSRPINNMTATYNQLSRSTSGPRPGCQPSS
PCVPKLSNSDSQDIQGRNRDSQNGAIAPGHVSVIRPPQNLYPENIVPSFSPGPSGRYGAS
GRSEGGRNSRVTPAAANYRSRTAKAKPSKQQGAGDAEEEEEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14545	1.000	1.000	0.000	582	1.000	1.000	O14545.pdb.gz	TRAD1_HUMAN TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1
2	AFDB:Q3UDK1	0.274	0.275	4.362E-82	580	0.763	0.766	Q3UDK1.pdb.gz	TRAD1_MOUSE TRAF-type zinc finger domain-containing protein 1 OS=Mus musculus OX=10090 GN=Trafd1 PE=1 SV=1
3	AFDB:O15090	0.098	0.055	4.588E-6	1300	0.151	0.068	O15090.pdb.gz	ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens OX=9606 GN=ZNF536 PE=1 SV=3
4	AFDB:Q9EPT3	0.095	0.085	6.846E-6	675	0.165	0.142	Q9EPT3.pdb.gz	Q9EPT3_MOUSE Lost on transformation protein 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
5	AFDB:Q13029	0.080	0.037	4.738E-5	1718	0.151	0.051	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
6	AFDB:Q9JLQ4	0.082	0.071	7.070E-5	704	0.175	0.145	Q9JLQ4.pdb.gz	Q9JLQ4_MOUSE Pleiomorphic adenoma gene-like 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
7	AFDB:Q12263	0.066	0.039	1.289E-4	1142	0.110	0.056	Q12263.pdb.gz	GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIN4 PE=1 SV=1
8	AFDB:P0CS62	0.077	0.056	5.978E-4	917	0.167	0.106	P0CS62.pdb.gz	PACC_CRYNJ pH-response transcription factor pacC/RIM101 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=RIM101 PE=3 SV=1
9	AFDB:A0A1D8PNL1	0.064	0.065	8.920E-4	570	0.143	0.146	A0A1D8PNL1.pdb.gz	A0A1D8PNL1_CANAL Transcription factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MIG1 PE=4 SV=1
10	AFDB:Q64127	0.064	0.043	2.426E-3	1051	0.148	0.082	Q64127.pdb.gz	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
11	PDB:5dkaA	0.056	0.289	2.533E-2	96	0.024	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4kblA	0.061	0.074	8.418E-2	395	0.053	0.078	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
13	PDB:3w5kB	0.085	0.261	1.099E-1	110	0.036	0.191	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
14	PDB:7o4iW	0.056	0.093	2.797E-1	312	0.062	0.115	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:6o9lQ	0.059	0.075	6.658E-1	430	0.074	0.100	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
16	PDB:7b5lH	0.054	0.069	6.658E-1	423	0.041	0.057	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
17	PDB:7v3vI	0.076	0.120	9.934E-1	328	0.055	0.098	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
18	PDB:4z4kA	0.037	0.073	1.214	282	0.022	0.046	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
19	PDB:5wlcST	0.045	0.045	1.811	599	0.034	0.033	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
20	PDB:7pubDS	0.053	0.101	1.811	243	0.055	0.132	7pubDS.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14545	0.0	1202	582	1.000	1.000	TRAD1_HUMAN TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1
2	Q3UDK1	0.0	899	580	0.754	0.757	TRAD1_MOUSE TRAF-type zinc finger domain-containing protein 1 OS=Mus musculus OX=10090 GN=Trafd1 PE=1 SV=1
3	Q99MM4	0.0	877	576	0.746	0.753	TRAD1_RAT TRAF-type zinc finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Trafd1 PE=1 SV=2
4	Q6GPH4	6.81e-27	113	301	0.095	0.183	XAF1_HUMAN XIAP-associated factor 1 OS=Homo sapiens OX=9606 GN=XAF1 PE=1 SV=1
5	D3ZPQ3	3.72e-18	87.4	282	0.082	0.170	D3ZPQ3_RAT XIAP associated factor 1 OS=Rattus norvegicus OX=10116 GN=Xaf1 PE=1 SV=4
6	A0A8I5ZLW0	2.08e-15	79.3	284	0.143	0.292	A0A8I5ZLW0_RAT XIAP associated factor 1 OS=Rattus norvegicus OX=10116 GN=Xaf1 PE=1 SV=1
7	M0R7W3	1.36e-09	60.1	188	0.041	0.128	M0R7W3_RAT XIAP associated factor 1 OS=Rattus norvegicus OX=10116 GN=Xaf1 PE=1 SV=2
8	Q385V1	0.001	44.7	690	0.082	0.070	Q385V1_TRYB2 Kinesin-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2260 PE=3 SV=1
9	Q7T1K2	0.001	43.9	470	0.058	0.072	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
10	Q4QGE1	0.002	43.1	729	0.060	0.048	Q4QGE1_LEIMA Kinesin-like protein OS=Leishmania major OX=5664 GN=LMJF_13_0130 PE=3 SV=1
11	Q9VJN5	0.002	43.1	470	0.070	0.087	WEK_DROME Zinc finger protein weckle OS=Drosophila melanogaster OX=7227 GN=wek PE=1 SV=1
12	P70196	0.004	42.4	530	0.046	0.051	TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2
13	Q60803	0.008	41.6	567	0.052	0.053	TRAF3_MOUSE TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2
14	Q9XYR0	0.025	39.7	486	0.043	0.051	Q9XYR0_DROME LD20987p OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=1 SV=1
15	Q61382	0.031	39.7	470	0.040	0.049	TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2
16	E1C626	0.033	39.7	545	0.045	0.048	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
17	A8DYU9	0.037	39.3	477	0.043	0.052	A8DYU9_DROME TNF-receptor-associated factor 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=4 SV=2
18	Q9UAC5	0.040	39.3	412	0.043	0.061	Q9UAC5_DROME TRAF1 OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=2 SV=1
19	Q6DJN2	0.043	39.3	556	0.046	0.049	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
20	B5DFH7	0.046	38.9	497	0.036	0.042	B5DFH7_RAT TNF receptor-associated factor OS=Rattus norvegicus OX=10116 GN=Traf2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18048 TRAF6_Z2	83	14.6	TNF receptor-associated factor 6 zinc finger 2
2	PF18608 XAF1_C	23	16.0	XIAP-associated factor 1 C-terminal domain
3	PF18439 zf_UBZ	5.5	18.0	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257604

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364166	0.757	Transmembrane protein 225
2	9606.ENSP00000411565	0.730	Dehydrogenase/reductase SDR family member 12
3	9606.ENSP00000334437	0.707	Nucleoside diphosphate-linked moiety X motif 17
4	9606.ENSP00000280700	0.680	Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
5	9606.ENSP00000401980	0.676	Mitochondrial antiviral-signaling protein
6	9606.ENSP00000327234	0.663	Transmembrane and coiled-coil domains 5A
7	9606.ENSP00000331152	0.636	Max-interacting protein 1
8	9606.ENSP00000454207	0.560	TNF receptor-associated factor 3
9	9606.ENSP00000366237	0.553	DNA fragmentation factor subunit alpha
10	9606.ENSP00000370253	0.540	Homeobox protein Nkx-3.1
11	9606.ENSP00000248244	0.538	TIR domain-containing adapter molecule 1
12	9606.ENSP00000433623	0.537	TNF receptor-associated factor 6
13	9606.ENSP00000453177	0.500	E3 ubiquitin-protein ligase TRIM69

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.357	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0050789	0.988	regulation of biological process
GO:0002831	0.981	regulation of response to biotic stimulus
GO:0048519	0.977	negative regulation of biological process
GO:0080134	0.976	regulation of response to stress
GO:0010033	0.967	response to organic substance
GO:0045088	0.960	regulation of innate immune response
GO:0050794	0.829	regulation of cellular process
GO:0009987	0.790	cellular process
GO:0048585	0.755	negative regulation of response to stimulus
GO:0002832	0.740	negative regulation of response to biotic stimulus
GO:0031348	0.710	negative regulation of defense response
GO:0032102	0.667	negative regulation of response to external stimulus
GO:0034097	0.660	response to cytokine
GO:0019222	0.422	regulation of metabolic process
GO:0060255	0.390	regulation of macromolecule metabolic process
GO:0048523	0.377	negative regulation of cellular process
GO:0050777	0.368	negative regulation of immune response
GO:0071704	0.360	organic substance metabolic process
GO:0048518	0.358	positive regulation of biological process
GO:0051716	0.356	cellular response to stimulus
GO:0045824	0.356	negative regulation of innate immune response
GO:0044238	0.347	primary metabolic process
GO:0006807	0.300	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0005634	0.990	nucleus
GO:0016020	0.586	membrane
GO:0070013	0.404	intracellular organelle lumen
GO:0005654	0.380	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]