StarFunc result for job id O14548

User Input

>input (114 residues)
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKV
PELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14548	1.000	1.000	6.125E-19	114	1.000	1.000	O14548.pdb.gz	COX7R_HUMAN Cytochrome c oxidase subunit 7A-related protein, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A2L PE=1 SV=2
2	AFDB:E5RJZ1	0.285	0.395	1.115E-8	79	0.596	0.861	E5RJZ1.pdb.gz	E5RJZ1_HUMAN Cytochrome c oxidase subunit 7A2 like OS=Homo sapiens OX=9606 GN=COX7A2L PE=1 SV=1
3	AFDB:H0YBD2	0.154	0.182	3.001E-6	95	0.588	0.705	H0YBD2.pdb.gz	H0YBD2_HUMAN Cytochrome c oxidase subunit 7A2 like (Fragment) OS=Homo sapiens OX=9606 GN=COX7A2L PE=1 SV=1
4	AFDB:P48771	0.515	0.685	3.692E-6	83	0.307	0.422	P48771.pdb.gz	CX7A2_MOUSE Cytochrome c oxidase subunit 7A2, mitochondrial OS=Mus musculus OX=10090 GN=Cox7a2 PE=1 SV=2
5	AFDB:P14406	0.529	0.710	4.542E-6	83	0.316	0.434	P14406.pdb.gz	CX7A2_HUMAN Cytochrome c oxidase subunit 7A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A2 PE=1 SV=1
6	AFDB:P07470	0.519	0.726	7.366E-6	80	0.298	0.425	P07470.pdb.gz	CX7A1_BOVIN Cytochrome c oxidase subunit 7A1, mitochondrial OS=Bos taurus OX=9913 GN=COX7A1 PE=1 SV=2
7	AFDB:P56392	0.514	0.720	2.384E-5	80	0.307	0.438	P56392.pdb.gz	CX7A1_MOUSE Cytochrome c oxidase subunit 7A1, mitochondrial OS=Mus musculus OX=10090 GN=Cox7a1 PE=1 SV=1
8	AFDB:P24310	0.469	0.659	2.933E-5	79	0.263	0.380	P24310.pdb.gz	CX7A1_HUMAN Cytochrome c oxidase subunit 7A1, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A1 PE=1 SV=2
9	PDB:2y69J	0.473	0.912	1.298E-4	57	0.254	0.509	2y69J.pdb.gz	A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
10	AFDB:Q9VHS2	0.421	0.525	4.239E-3	89	0.193	0.247	Q9VHS2.pdb.gz	COX7A_DROME Cytochrome c oxidase subunit 7A, mitochondrial OS=Drosophila melanogaster OX=7227 GN=COX7A PE=3 SV=1
11	PDB:6hu9g	0.342	0.546	6.813E-1	59	0.114	0.220	6hu9g.pdb.gz	Structure of yeast cytochrome c oxidase in a supercomplex with cytochrome bc1.
12	AFDB:Q38D40	0.301	0.133	2.277	297	0.140	0.054	Q38D40.pdb.gz	Q38D40_TRYB2 Reiske iron-sulfur protein, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4700 PE=3 SV=1
13	PDB:5mpsK	0.228	0.141	5.799	187	0.149	0.091	5mpsK.pdb.gz	Structure of a spliceosome remodelled for exon ligation.
14	PDB:7w5a2	0.261	0.243	9.404	123	0.088	0.081	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14548	9.41e-81	233	114	1.000	1.000	COX7R_HUMAN Cytochrome c oxidase subunit 7A-related protein, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A2L PE=1 SV=2
2	Q6FGA0	9.41e-81	233	114	1.000	1.000	Q6FGA0_HUMAN COX7A2L protein OS=Homo sapiens OX=9606 GN=COX7A2L PE=2 SV=1
3	Q61387	1.72e-68	202	111	0.886	0.910	COX7R_MOUSE Cytochrome c oxidase subunit 7A-related protein, mitochondrial OS=Mus musculus OX=10090 GN=Cox7a2l PE=1 SV=1
4	E5RJZ1	2.02e-44	140	79	0.596	0.861	E5RJZ1_HUMAN Cytochrome c oxidase subunit 7A2 like OS=Homo sapiens OX=9606 GN=COX7A2L PE=1 SV=1
5	H0YBD2	1.27e-40	132	95	0.561	0.674	H0YBD2_HUMAN Cytochrome c oxidase subunit 7A2 like (Fragment) OS=Homo sapiens OX=9606 GN=COX7A2L PE=1 SV=1
6	P14406	8.46e-17	71.2	83	0.298	0.410	CX7A2_HUMAN Cytochrome c oxidase subunit 7A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A2 PE=1 SV=1
7	P48771	1.59e-16	70.5	83	0.307	0.422	CX7A2_MOUSE Cytochrome c oxidase subunit 7A2, mitochondrial OS=Mus musculus OX=10090 GN=Cox7a2 PE=1 SV=2
8	P24310	1.44e-14	65.5	79	0.254	0.367	CX7A1_HUMAN Cytochrome c oxidase subunit 7A1, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A1 PE=1 SV=2
9	P07470	5.94e-14	63.9	80	0.263	0.375	CX7A1_BOVIN Cytochrome c oxidase subunit 7A1, mitochondrial OS=Bos taurus OX=9913 GN=COX7A1 PE=1 SV=2
10	P56392	1.14e-13	63.2	80	0.272	0.388	CX7A1_MOUSE Cytochrome c oxidase subunit 7A1, mitochondrial OS=Mus musculus OX=10090 GN=Cox7a1 PE=1 SV=1
11	Q9VHS2	2.25e-05	42.0	89	0.193	0.247	COX7A_DROME Cytochrome c oxidase subunit 7A, mitochondrial OS=Drosophila melanogaster OX=7227 GN=COX7A PE=3 SV=1
12	B6ZI38	0.67	31.2	349	0.167	0.054	DRAXI_CHICK Draxin OS=Gallus gallus OX=9031 GN=DRAXIN PE=1 SV=1
13	F6NMW9	2.5	29.6	1685	0.158	0.011	F6NMW9_DANRE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X2 OS=Danio rerio OX=7955 GN=pik3c2a PE=1 SV=1
14	E9QA28	2.6	29.6	426	0.167	0.045	CEA16_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 16 OS=Mus musculus OX=10090 GN=Ceacam16 PE=1 SV=1
15	A5PMI2	6.6	28.5	1216	0.202	0.019	A5PMI2_DANRE Zinc finger FYVE domain-containing protein 9 isoform X1 OS=Danio rerio OX=7955 GN=zfyve9a PE=4 SV=2
16	P24821	8.3	28.1	2201	0.140	0.007	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
17	Q9ZQF1	8.3	28.1	627	0.149	0.027	PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g15630 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02238 COX7a	1.4e-06	39.9	Cytochrome c oxidase subunit VII

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020225

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000022672	0.994	NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase)
2	61853.ENSNLEP00000020044	0.938	Cytochrome b-c1 complex subunit 6
3	61853.ENSNLEP00000009229	0.923	Cytochrome b-c1 complex subunit Rieske, mitochondrial
4	61853.ENSNLEP00000013438	0.920	NADH:ubiquinone oxidoreductase subunit S4
5	61853.ENSNLEP00000003482	0.900	Cytochrome c oxidase subunit VIc
6	61853.ENSNLEP00000005993	0.890	Translocase of inner mitochondrial membrane domain containing 1
7	61853.ENSNLEP00000015621	0.875	Ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
8	61853.ENSNLEP00000006004	0.861	Cytochrome c oxidase subunit VIIa polypeptide 2 (liver)
9	61853.ENSNLEP00000013886	0.824	Cytochrome c oxidase subunit IV isoform 1
10	61853.ENSNLEP00000017885	0.814	Uncharacterized protein
11	61853.ENSNLEP00000023483	0.814	Cytochrome c oxidase subunit 5A
12	61853.ENSNLEP00000022224	0.808	Cytochrome c oxidase subunit VIIb
13	61853.ENSNLEP00000022820	0.808	Cytochrome c oxidase subunit VIIb2
14	61853.ENSNLEP00000013711	0.796	Cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
15	61853.ENSNLEP00000016295	0.793	Uncharacterized protein
16	61853.ENSNLEP00000022818	0.793	Uncharacterized protein
17	61853.ENSNLEP00000022909	0.793	Uncharacterized protein
18	61853.ENSNLEP00000014197	0.785	Uncharacterized protein
19	61853.ENSNLEP00000019806	0.780	Cytochrome c oxidase subunit VIa polypeptide 2
20	61853.ENSNLEP00000022306	0.762	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004129	1.000	cytochrome-c oxidase activity
GO:0005515	0.635	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0007005	0.991	mitochondrion organization
GO:0065003	0.985	protein-containing complex assembly
GO:0050789	0.956	regulation of biological process
GO:0050794	0.954	regulation of cellular process
GO:0043467	0.863	regulation of generation of precursor metabolites and energy
GO:0008152	0.713	metabolic process
GO:0044237	0.612	cellular metabolic process
GO:0006091	0.566	generation of precursor metabolites and energy
GO:0045333	0.330	cellular respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005740	0.999	mitochondrial envelope
GO:0031090	0.998	organelle membrane
GO:0031981	0.992	nuclear lumen
GO:0019866	0.975	organelle inner membrane
GO:0032991	0.969	protein-containing complex
GO:0005743	0.956	mitochondrial inner membrane
GO:0098796	0.948	membrane protein complex
GO:0098798	0.935	mitochondrial protein-containing complex
GO:0098800	0.934	inner mitochondrial membrane protein complex
GO:0098803	0.931	respiratory chain complex
GO:1902494	0.926	catalytic complex
GO:0043232	0.907	intracellular non-membrane-bounded organelle
GO:0005746	0.881	mitochondrial respirasome
GO:0005730	0.776	nucleolus
GO:0005654	0.302	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11436	1.000	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	1.000	cytochrome-c oxidase.

[back to server]