StarFunc result for job id O14556

User Input

>input (408 residues)
MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPP
HPATPPPKMVSVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKY
DSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAAS
DHISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERF
GIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKL
TGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLG
DTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14556	1.000	1.000	1.884E-89	408	1.000	1.000	O14556.pdb.gz	G3PT_HUMAN Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Homo sapiens OX=9606 GN=GAPDHS PE=1 SV=2
2	AFDB:Q64467	0.840	0.779	4.953E-76	440	0.824	0.764	Q64467.pdb.gz	G3PT_MOUSE Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Mus musculus OX=10090 GN=Gapdhs PE=1 SV=1
3	AFDB:P78958	0.814	0.987	1.812E-64	336	0.551	0.670	P78958.pdb.gz	G3P1_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tdh1 PE=1 SV=1
4	AFDB:P07486	0.806	0.990	1.926E-64	332	0.564	0.693	P07486.pdb.gz	G3P1_DROME Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Drosophila melanogaster OX=7227 GN=Gapdh1 PE=2 SV=2
5	AFDB:P04406	0.808	0.983	3.139E-64	335	0.559	0.681	P04406.pdb.gz	G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3
6	AFDB:Q5ADM7	0.812	0.988	2.829E-63	335	0.539	0.657	Q5ADM7.pdb.gz	Q5ADM7_CANAL Glyceraldehyde-3-phosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TDH3 PE=1 SV=1
7	AFDB:Q9SAJ6	0.818	0.791	3.611E-63	422	0.547	0.528	Q9SAJ6.pdb.gz	G3PP1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPCP1 PE=1 SV=1
8	AFDB:Q5E924	0.809	0.786	1.152E-62	420	0.556	0.540	Q5E924.pdb.gz	G3PP2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPCP2 PE=2 SV=1
9	PDB:6m61O	0.808	0.981	2.016E-62	336	0.559	0.679	6m61O.pdb.gz	Biosynthesis of the fungal glyceraldehyde-3-phosphate dehydrogenase inhibitor heptelidic acid and mechanism of self-resistance
10	AFDB:P20445	0.811	0.984	5.638E-62	336	0.517	0.628	P20445.pdb.gz	G3P_EMENI Glyceraldehyde-3-phosphate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpdA PE=1 SV=2
11	AFDB:Q12552	0.811	0.984	8.133E-62	336	0.522	0.634	Q12552.pdb.gz	G3P_ASPNG Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus niger OX=5061 GN=gpdA PE=3 SV=2
12	PDB:3cifA	0.807	0.973	1.251E-58	338	0.525	0.633	3cifA.pdb.gz	An unexpected phosphate binding site in Glyceraldehyde 3-Phosphate Dehydrogenase: Crystal structures of apo, holo and ternary complex of Cryptosporidium parvum enzyme
13	PDB:3pymA	0.798	0.980	5.756E-58	332	0.517	0.636	3pymA.pdb.gz	?
14	PDB:1dc4A	0.790	0.975	1.168E-55	330	0.510	0.630	1dc4A.pdb.gz	Structural analysis of glyceraldehyde 3-phosphate dehydrogenase from Escherichia coli: direct evidence of substrate binding and cofactor-induced conformational changes.
15	PDB:6qunO	0.800	0.976	2.919E-55	334	0.522	0.638	6qunO.pdb.gz	Glutathionylation primes soluble glyceraldehyde-3-phosphate dehydrogenase for late collapse into insoluble aggregates.
16	PDB:3cmcO	0.801	0.976	8.701E-52	334	0.419	0.512	3cmcO.pdb.gz	Trapping of the Thioacylglyceraldehyde-3-phosphate Dehydrogenase Intermediate from Bacillus stearothermophilus: DIRECT EVIDENCE FOR A FLIP-FLOP MECHANISM
17	PDB:7zq3R	0.801	0.938	1.224E-49	348	0.368	0.431	7zq3R.pdb.gz	Structural snapshots of nitrosoglutathione binding and reactivity underlying S-nitrosylation of photosynthetic GAPDH.
18	PDB:3hjaA	0.778	0.948	3.252E-49	334	0.397	0.485	3hjaA.pdb.gz	Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Borrelia burgdorferi
19	PDB:1cerO	0.794	0.976	8.639E-49	331	0.390	0.480	1cerO.pdb.gz	Determinants of enzyme thermostability observed in the molecular structure of Thermus aquaticus D-glyceraldehyde-3-phosphate dehydrogenase at 25 Angstroms Resolution.
20	PDB:1hdgO	0.781	0.957	9.183E-49	332	0.380	0.467	1hdgO.pdb.gz	The crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium Thermotoga maritima at 2.5 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14556	0.0	840	408	1.000	1.000	G3PT_HUMAN Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Homo sapiens OX=9606 GN=GAPDHS PE=1 SV=2
2	Q64467	0.0	624	440	0.718	0.666	G3PT_MOUSE Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Mus musculus OX=10090 GN=Gapdhs PE=1 SV=1
3	Q9ESV6	0.0	627	432	0.718	0.678	G3PT_RAT Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Rattus norvegicus OX=10116 GN=Gapdhs PE=1 SV=1
4	P00356	1.23e-176	497	333	0.578	0.709	G3P_CHICK Glyceraldehyde-3-phosphate dehydrogenase OS=Gallus gallus OX=9031 GN=GAPDH PE=2 SV=3
5	P07487	9.28e-174	490	332	0.566	0.696	G3P2_DROME Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila melanogaster OX=7227 GN=Gapdh2 PE=1 SV=2
6	P16858	1.26e-173	489	333	0.569	0.697	G3P_MOUSE Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2
7	P10096	2.57e-173	489	333	0.566	0.694	G3P_BOVIN Glyceraldehyde-3-phosphate dehydrogenase OS=Bos taurus OX=9913 GN=GAPDH PE=1 SV=4
8	P07486	4.24e-173	488	332	0.564	0.693	G3P1_DROME Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Drosophila melanogaster OX=7227 GN=Gapdh1 PE=2 SV=2
9	P04797	2.22e-172	486	333	0.569	0.697	G3P_RAT Glyceraldehyde-3-phosphate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Gapdh PE=1 SV=3
10	P04406	2.13e-171	484	335	0.559	0.681	G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3
11	V9HVZ4	2.13e-171	484	335	0.559	0.681	V9HVZ4_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=HEL-S-162eP PE=2 SV=1
12	P46406	8.29e-171	483	333	0.564	0.691	G3P_RABIT Glyceraldehyde-3-phosphate dehydrogenase OS=Oryctolagus cuniculus OX=9986 GN=GAPDH PE=1 SV=3
13	O43026	8.96e-170	480	335	0.561	0.684	G3P2_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd3 PE=1 SV=1
14	P78958	5.73e-168	475	336	0.554	0.673	G3P1_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tdh1 PE=1 SV=1
15	Q5E924	1.46e-162	465	420	0.547	0.531	G3PP2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPCP2 PE=2 SV=1
16	Q94469	7.71e-162	460	335	0.544	0.663	G3P_DICDI Glyceraldehyde-3-phosphate dehydrogenase OS=Dictyostelium discoideum OX=44689 GN=gpdA PE=1 SV=2
17	Q5ADM7	8.69e-162	459	335	0.539	0.657	Q5ADM7_CANAL Glyceraldehyde-3-phosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TDH3 PE=1 SV=1
18	Q9SAJ6	9.90e-160	458	422	0.537	0.519	G3PP1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GAPCP1 PE=1 SV=1
19	Q43247	2.20e-157	449	337	0.532	0.644	G3PC3_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic OS=Zea mays OX=4577 GN=GAPC3 PE=2 SV=1
20	P08735	2.40e-157	448	337	0.525	0.635	G3PC1_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Zea mays OX=4577 GN=GAPC1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	0.73	20.6	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF02800 Gp_dh_C	1.8e-65	230.8	Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
3	PF00044 Gp_dh_N	3.4e-32	122.1	Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
4	PF13691 Lactamase_B_4	5.5e+02	11.7	tRNase Z endonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222286

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229270	0.997	Triosephosphate isomerase 1
2	9606.ENSP00000305995	0.994	Phosphoglycerate kinase 2
3	9606.ENSP00000362413	0.988	Phosphoglycerate kinase 1
4	9606.ENSP00000405573	0.971	Glucose-6-phosphate isomerase
5	9606.ENSP00000378669	0.964	Fructose-bisphosphate aldolase A
6	9606.ENSP00000363988	0.962	Belongs to the class I fructose-bisphosphate aldolase family
7	9606.ENSP00000226253	0.960	Belongs to the class I fructose-bisphosphate aldolase family
8	9606.ENSP00000377192	0.951	Glucose-6-phosphate 1-dehydrogenase
9	9606.ENSP00000473348	0.941	GDH/6PGL endoplasmic bifunctional protein
10	9606.ENSP00000376840	0.940	Bisphosphoglycerate mutase
11	9606.ENSP00000321259	0.911	Transaldolase
12	9606.ENSP00000391481	0.896	Transketolase
13	9606.ENSP00000280605	0.894	Transketolase-like protein 2
14	9606.ENSP00000358931	0.894	Transketolase-like protein 1
15	9606.ENSP00000229239	0.861	Glyceraldehyde-3-phosphate dehydrogenase
16	9606.ENSP00000357726	0.844	Protein S100-A12
17	9606.ENSP00000234590	0.842	Alpha-enolase
18	9606.ENSP00000353785	0.841	Tubulin polymerization-promoting protein
19	9606.ENSP00000324105	0.840	Beta-enolase
20	9606.ENSP00000339933	0.826	Pyruvate kinase PKLR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004365	1.000	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0005515	0.996	protein binding
GO:0097159	0.951	organic cyclic compound binding
GO:1901363	0.644	heterocyclic compound binding
GO:0036094	0.552	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.969	regulation of cellular process
GO:0009987	0.957	cellular process
GO:0071704	0.941	organic substance metabolic process
GO:0019222	0.924	regulation of metabolic process
GO:0031323	0.863	regulation of cellular metabolic process
GO:0044238	0.817	primary metabolic process
GO:0051173	0.790	positive regulation of nitrogen compound metabolic process
GO:0010562	0.787	positive regulation of phosphorus metabolic process
GO:0062013	0.733	positive regulation of small molecule metabolic process
GO:0042325	0.728	regulation of phosphorylation
GO:0080090	0.725	regulation of primary metabolic process
GO:0006110	0.723	regulation of glycolytic process
GO:0006807	0.722	nitrogen compound metabolic process
GO:0045937	0.706	positive regulation of phosphate metabolic process
GO:0044237	0.697	cellular metabolic process
GO:0045935	0.685	positive regulation of nucleobase-containing compound metabolic process
GO:0045981	0.651	positive regulation of nucleotide metabolic process
GO:1901564	0.573	organonitrogen compound metabolic process
GO:0031331	0.567	positive regulation of cellular catabolic process
GO:1900544	0.531	positive regulation of purine nucleotide metabolic process
GO:0045913	0.528	positive regulation of carbohydrate metabolic process
GO:0034641	0.497	cellular nitrogen compound metabolic process
GO:0006796	0.496	phosphate-containing compound metabolic process
GO:0044281	0.486	small molecule metabolic process
GO:0009056	0.467	catabolic process
GO:0006139	0.433	nucleobase-containing compound metabolic process
GO:1903580	0.417	positive regulation of ATP metabolic process
GO:0060255	0.396	regulation of macromolecule metabolic process
GO:0019637	0.373	organophosphate metabolic process
GO:0006163	0.347	purine nucleotide metabolic process
GO:1901135	0.334	carbohydrate derivative metabolic process
GO:0005975	0.320	carbohydrate metabolic process
GO:1901575	0.313	organic substance catabolic process
GO:0010604	0.307	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.978	nucleus
GO:0031982	0.679	vesicle
GO:0016020	0.357	membrane
GO:0005654	0.317	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10300	1.000	D-glyceraldehyde 3-phosphate + NAD(+) + phosphate = (2R)-3-phospho-glyceroyl phosphate + H(+) + NADH
EC:1.2.1.12	1.000	glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).

[back to server]