StarFunc result for job id O14559

User Input

>input (1287 residues)
MVARSTDSLDGPGEGSVQPLPTAGGPSVKGKPGKRLSAPRGPFPRLADCAHFHYENVDFG
HIQLLLSPDREGPSLSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRCIFDRRFS
CLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGRRLLLSEE
ASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGFQVGFFPS
ECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQ
RLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSGVSSNIQR
LRHEFDSERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEE
RLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLRSMELES
VGMGGAAAFREVRVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKSLAGSCPST
RLLTLEEAQARTQGRLGTPTEPTTPKAPASPAERRKGERGEKQRKPGGSSWKTFFALGRG
PSVPRKKPLPWLGGTRAPPQPSGSRPDTVTLRSAKSEESLSSQASGAGLQRLHRLRRPHS
SSDAFPVGPAPAGSCESLSSSSSSESSSSESSSSSSESSAAGLGALSGSPSHRTSAWLDD
GDELDFSPPRCLEGLRGLDFDPLTFRCSSPTPGDPAPPASPAPPAPASAFPPRVTPQAIS
PRGPTSPASPAALDISEPLAVSVPPAVLELLGAGGAPASATPTPALSPGRSLRPHLIPLL
LRGAEAPLTDACQQEMCSKLRGAQGPLGPDMESPLPPPPLSLLRPGGAPPPPPKNPARLM
ALALAERAQQVAEQQSQQECGGTPPASQSPFHRSLSLEVGGEPLGTSGSGPPPNSLAHPG
AWVPGPPPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSAQLRAGGGGRDAPEAAAQSP
CSVPSQVPTPGFFSPAPRECLPPFLGVPKPGLYPLGPPSFQPSSPAPVWRSSLGPPAPLD
RGENLYYEIGASEGSPYSGPTRSWSPFRSMPPDRLNASYGMLGQSPPLHRSPDFLLSYPP
APSCFPPDHLGYSAPQHPARRPTPPEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPG
PPVPRLPQKQRAPWGPRTPHRVPGPWGPPEPLLLYRAAPPAYGRGGELHRGSLYRNGGQR
GEGAGPPPPYPTPSWSLHSEGQTRSYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A9G6	0.248	0.245	0.000	1310	0.880	0.864	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
2	AFDB:F1MAK3	0.275	0.180	2.236E-66	2101	0.395	0.242	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
3	AFDB:A7KAX9	0.274	0.188	2.484E-66	2087	0.382	0.236	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
4	AFDB:Q9VIS1	0.181	0.136	9.044E-51	1843	0.294	0.205	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
5	AFDB:A6X8Z5	0.165	0.150	1.826E-28	1425	0.241	0.218	A6X8Z5.pdb.gz	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
6	AFDB:Q2M1Z3	0.167	0.149	3.252E-28	1444	0.237	0.211	Q2M1Z3.pdb.gz	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
7	AFDB:Q7Z6I6	0.159	0.186	6.103E-28	1101	0.236	0.276	Q7Z6I6.pdb.gz	RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=3
8	AFDB:X2JEI9	0.152	0.093	2.823E-16	2206	0.179	0.105	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
9	AFDB:Q9VDS5	0.154	0.265	5.028E-16	740	0.081	0.141	Q9VDS5.pdb.gz	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
10	AFDB:Q6REY9	0.150	0.163	1.680E-15	1182	0.149	0.162	Q6REY9.pdb.gz	RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus OX=10116 GN=Arhgap20 PE=1 SV=2
11	PDB:3cxlA	0.147	0.459	6.310E-15	402	0.059	0.189	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
12	PDB:1xa6A	0.146	0.462	1.315E-14	399	0.055	0.178	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
13	PDB:6r3vA	0.146	0.898	3.420E-12	198	0.044	0.283	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
14	PDB:5jcpA	0.129	0.443	4.686E-12	361	0.044	0.158	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
15	PDB:5c2kA	0.131	0.425	3.842E-10	382	0.042	0.141	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:2dybA	0.071	0.240	9.481E-8	298	0.032	0.138	2dybA.pdb.gz
17	PDB:1griA	0.050	0.260	3.397E-4	211	0.022	0.133	1griA.pdb.gz
18	PDB:3qwyA	0.057	0.349	1.821E-3	170	0.017	0.129	3qwyA.pdb.gz
19	PDB:3ehqA	0.042	0.282	1.919E-3	182	0.015	0.104	3ehqA.pdb.gz
20	PDB:2lqnA	0.043	0.173	4.441E-3	303	0.026	0.112	2lqnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y6H2	0.0	740	2046	0.350	0.220	A0A8I5Y6H2_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
2	A0A8I6AJS5	0.0	1956	1309	0.910	0.895	A0A8I6AJS5_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=3 SV=1
3	A0A8I6GFW8	0.0	662	2070	0.325	0.202	A0A8I6GFW8_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
4	A0A8I6GIC6	0.0	734	2061	0.343	0.214	A0A8I6GIC6_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
5	A1A5D2	0.0	1459	748	0.566	0.975	A1A5D2_HUMAN SNX26 protein OS=Homo sapiens OX=9606 GN=SNX26 PE=1 SV=1
6	A7KAX9	0.0	741	2087	0.353	0.218	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
7	D4A9G6	0.0	1958	1354	0.911	0.866	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
8	F1MAK3	0.0	733	2101	0.343	0.210	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
9	O14559	0.0	2524	1287	1.000	1.000	RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens OX=9606 GN=ARHGAP33 PE=1 SV=2
10	Q80YF9	0.0	1937	1305	0.914	0.901	RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus OX=10090 GN=Arhgap33 PE=1 SV=1
11	Q811P8	0.0	738	2089	0.347	0.213	RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus OX=10090 GN=Arhgap32 PE=1 SV=2
12	Q9VIS1	2.12e-133	452	1843	0.183	0.128	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
13	Q2M1Z3	7.84e-88	315	1444	0.117	0.105	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
14	A6X8Z5	3.84e-85	307	1425	0.115	0.104	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
15	A0A0A0MRJ9	1.60e-83	295	890	0.163	0.236	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
16	Q20498	3.53e-71	256	759	0.124	0.211	RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans OX=6239 GN=rrc-1 PE=1 SV=3
17	Q6ZUM4	3.77e-36	150	889	0.083	0.120	RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens OX=9606 GN=ARHGAP27 PE=1 SV=3
18	Q6TLK4	1.40e-35	149	869	0.060	0.089	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
19	Q03070	3.74e-34	135	295	0.055	0.241	CHIO_RAT Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn2 PE=2 SV=1
20	P30337	6.56e-34	135	334	0.057	0.222	CHIN_RAT N-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00787 PX	44	16.2	PX domain
2	PF00620 RhoGAP	2e-41	152.8	RhoGAP domain
3	PF00018 SH3_1	7.7e-06	36.7	SH3 domain
4	PF07653 SH3_2	9.7e-07	39.8	Variant SH3 domain
5	PF14604 SH3_9	2.8e-07	41.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000016840

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000025053	0.779	Cell division cycle 42
2	9593.ENSGGOP00000013487	0.707	Neurotrophic tyrosine kinase, receptor, type 1
3	9593.ENSGGOP00000002701	0.694	Ras homolog family member C
4	9593.ENSGGOP00000012527	0.694	Ras homolog family member A
5	9593.ENSGGOP00000026185	0.673	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
6	9593.ENSGGOP00000012875	0.634	Ras homolog family member B
7	9593.ENSGGOP00000010349	0.629	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
8	9593.ENSGGOP00000011318	0.629	Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
9	9593.ENSGGOP00000007769	0.595	Ras homolog family member J
10	9593.ENSGGOP00000014613	0.587	Ras homolog family member D
11	9593.ENSGGOP00000017243	0.584	Uncharacterized protein
12	9593.ENSGGOP00000007740	0.581	Ras homolog family member U
13	9593.ENSGGOP00000012251	0.578	Ras homolog family member G
14	9593.ENSGGOP00000027163	0.572	Ras homolog family member F (in filopodia)
15	9593.ENSGGOP00000006608	0.542	CRK proto-oncogene, adaptor protein
16	9593.ENSGGOP00000016316	0.537	NCK interacting protein with SH3 domain
17	9593.ENSGGOP00000019115	0.531	Uncharacterized protein
18	9593.ENSGGOP00000028121	0.531	Ras homolog family member Q
19	9593.ENSGGOP00000005990	0.529	Growth factor receptor-bound protein 2
20	9593.ENSGGOP00000016691	0.526	Glutathione S-transferase, C-terminal domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.950	molecular function regulator activity
GO:0030234	0.908	enzyme regulator activity
GO:0008047	0.829	enzyme activator activity
GO:0030695	0.782	GTPase regulator activity
GO:0005096	0.753	GTPase activator activity
GO:0019899	0.526	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0099175	0.996	regulation of postsynapse organization
GO:0042221	0.989	response to chemical
GO:0022603	0.987	regulation of anatomical structure morphogenesis
GO:0031344	0.981	regulation of cell projection organization
GO:0120035	0.974	regulation of plasma membrane bounded cell projection organization
GO:0061001	0.892	regulation of dendritic spine morphogenesis
GO:0009636	0.841	response to toxic substance
GO:0009987	0.691	cellular process
GO:0032502	0.657	developmental process
GO:0048856	0.653	anatomical structure development
GO:0032501	0.632	multicellular organismal process
GO:0071840	0.615	cellular component organization or biogenesis
GO:0016043	0.612	cellular component organization
GO:0007275	0.590	multicellular organism development
GO:0048731	0.544	system development
GO:0048522	0.541	positive regulation of cellular process
GO:0051130	0.428	positive regulation of cellular component organization
GO:0007399	0.396	nervous system development
GO:0031346	0.356	positive regulation of cell projection organization
GO:0051239	0.342	regulation of multicellular organismal process
GO:2000026	0.332	regulation of multicellular organismal development
GO:0023051	0.323	regulation of signaling
GO:0010646	0.321	regulation of cell communication
GO:0048583	0.318	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0071944	0.994	cell periphery
GO:0016020	0.994	membrane
GO:0005829	0.980	cytosol
GO:0005886	0.978	plasma membrane
GO:0042995	0.924	cell projection
GO:0120025	0.875	plasma membrane bounded cell projection
GO:0043005	0.867	neuron projection
GO:0030054	0.823	cell junction
GO:0032991	0.741	protein-containing complex
GO:0098794	0.707	postsynapse
GO:0036477	0.650	somatodendritic compartment
GO:0030425	0.612	dendrite
GO:0043226	0.581	organelle
GO:0044309	0.552	neuron spine
GO:0043227	0.491	membrane-bounded organelle
GO:0043197	0.488	dendritic spine
GO:0043229	0.374	intracellular organelle
GO:0043231	0.327	intracellular membrane-bounded organelle
GO:0070013	0.305	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]