StarFunc result for job id O14561

User Input

>input (156 residues)
MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGR
VTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14561	1.000	1.000	1.700E-25	156	1.000	1.000	O14561.pdb.gz	ACPM_HUMAN Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=3
2	AFDB:P52505	0.604	0.604	3.943E-21	156	0.872	0.872	P52505.pdb.gz	ACPM_BOVIN Acyl carrier protein, mitochondrial OS=Bos taurus OX=9913 GN=NDUFAB1 PE=1 SV=2
3	AFDB:Q9CR21	0.617	0.617	5.031E-21	156	0.859	0.859	Q9CR21.pdb.gz	ACPM_MOUSE Acyl carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Ndufab1 PE=1 SV=1
4	PDB:7ak5U	0.536	0.928	1.250E-11	88	0.545	0.966	7ak5U.pdb.gz	Structural basis for a complex I mutation that blocks pathological ROS production.
5	AFDB:P11943	0.522	0.595	1.622E-9	134	0.333	0.388	P11943.pdb.gz	ACPM_NEUCR Acyl carrier protein, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=nuo-12 PE=1 SV=2
6	AFDB:P53665	0.495	0.631	2.338E-9	122	0.288	0.369	P53665.pdb.gz	ACPM1_ARATH Acyl carrier protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP1 PE=1 SV=1
7	AFDB:Q57WW9	0.522	0.549	1.009E-8	148	0.276	0.291	Q57WW9.pdb.gz	Q57WW9_TRYB2 Acyl carrier protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.580 PE=1 SV=1
8	AFDB:O80800	0.519	0.638	1.454E-8	126	0.301	0.373	O80800.pdb.gz	ACPM2_ARATH Acyl carrier protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP2 PE=1 SV=1
9	AFDB:Q9FGJ4	0.481	0.571	9.040E-8	131	0.250	0.298	Q9FGJ4.pdb.gz	ACPM3_ARATH Acyl carrier protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP2 PE=1 SV=1
10	AFDB:P32463	0.483	0.595	1.564E-7	125	0.250	0.312	P32463.pdb.gz	ACPM_YEAST Acyl carrier protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACP1 PE=1 SV=1
11	AFDB:Q10217	0.499	0.688	2.396E-7	112	0.263	0.366	Q10217.pdb.gz	ACPM_SCHPO Putative acyl carrier protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.09 PE=3 SV=1
12	PDB:6sgaFc	0.478	0.869	2.728E-7	84	0.224	0.417	6sgaFc.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
13	PDB:7ar8T	0.473	0.854	2.165E-6	84	0.237	0.440	7ar8T.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
14	PDB:7a23e	0.451	0.784	3.120E-6	84	0.244	0.452	7a23e.pdb.gz	Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
15	PDB:3ejbA	0.440	0.834	3.792E-5	78	0.212	0.423	3ejbA.pdb.gz	Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
16	PDB:1klpA	0.445	0.578	5.601E-3	115	0.167	0.226	1klpA.pdb.gz
17	PDB:4h2uD	0.367	0.664	4.723E-2	78	0.109	0.218	4h2uD.pdb.gz	Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
18	PDB:4neoA	0.417	0.737	5.019E-2	83	0.051	0.096	4neoA.pdb.gz
19	PDB:7rluA	0.364	0.111	8.171E-2	583	0.077	0.021	7rluA.pdb.gz	Structure of putative tumor suppressor ALDH1L1.
20	PDB:2n5hA	0.410	0.648	9.810E-2	90	0.096	0.167	2n5hA.pdb.gz	Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14561	8.52e-112	315	156	1.000	1.000	ACPM_HUMAN Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=3
2	P52505	4.55e-93	268	156	0.872	0.872	ACPM_BOVIN Acyl carrier protein, mitochondrial OS=Bos taurus OX=9913 GN=NDUFAB1 PE=1 SV=2
3	Q9CR21	8.40e-93	267	156	0.859	0.859	ACPM_MOUSE Acyl carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Ndufab1 PE=1 SV=1
4	O80800	9.06e-21	84.0	126	0.244	0.302	ACPM2_ARATH Acyl carrier protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP2 PE=1 SV=1
5	P11943	1.81e-20	83.6	134	0.288	0.336	ACPM_NEUCR Acyl carrier protein, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=nuo-12 PE=1 SV=2
6	P53665	8.22e-18	76.3	122	0.237	0.303	ACPM1_ARATH Acyl carrier protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP1 PE=1 SV=1
7	Q57WW9	1.01e-16	74.3	148	0.218	0.230	Q57WW9_TRYB2 Acyl carrier protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.580 PE=1 SV=1
8	P32463	6.26e-16	71.6	125	0.244	0.304	ACPM_YEAST Acyl carrier protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACP1 PE=1 SV=1
9	Q10217	2.17e-15	69.7	112	0.212	0.295	ACPM_SCHPO Putative acyl carrier protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.09 PE=3 SV=1
10	Q9FGJ4	2.47e-15	70.1	131	0.218	0.260	ACPM3_ARATH Acyl carrier protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP2 PE=1 SV=1
11	P0A6A8	4.68e-14	65.5	78	0.199	0.397	ACP_ECOLI Acyl carrier protein OS=Escherichia coli (strain K12) OX=83333 GN=acpP PE=1 SV=2
12	Q7KWJ1	3.88e-12	62.0	137	0.199	0.226	Q7KWJ1_PLAF7 Acyl carrier protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0208500 PE=3 SV=1
13	Q72CS8	1.02e-11	59.3	76	0.173	0.355	ACP_DESVH Acyl carrier protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acpP PE=1 SV=1
14	Q9SW21	7.08e-07	48.1	137	0.147	0.168	ACP4_ARATH Acyl carrier protein 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ACP4 PE=2 SV=1
15	P11829	6.35e-06	45.4	137	0.141	0.161	ACP1_ARATH Acyl carrier protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ACP1 PE=1 SV=1
16	O04652	1.52e-05	44.3	139	0.160	0.180	ACP5_ARATH Acyl carrier protein 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ACP5 PE=3 SV=1
17	P9WQF3	2.16e-05	43.5	115	0.141	0.191	ACPM_MYCTU Meromycolate extension acyl carrier protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acpM PE=1 SV=1
18	P07854	4.23e-05	43.1	138	0.135	0.152	ACP1_SPIOL Acyl carrier protein 1, chloroplastic OS=Spinacia oleracea OX=3562 GN=ACL1.1 PE=1 SV=2
19	P25702	7.04e-05	42.7	136	0.192	0.221	ACP3_ARATH Acyl carrier protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ACP3 PE=1 SV=2
20	P25701	9.53e-05	42.4	136	0.218	0.250	ACP2_ARATH Acyl carrier protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ACP2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03776 MinE	3.1e+02	12.8	Septum formation topological specificity factor MinE
2	PF00550 PP-binding	2e-08	45.8	Phosphopantetheine attachment site
3	PF14573 PP-binding_2	63	15.2	Acyl-carrier

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000458770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000237889	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
5	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
6	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
7	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
8	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
9	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
10	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
11	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
12	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
13	9606.ENSP00000281031	0.999	NADH dehydrogenase [ubiquinone] 1 subunit C2
14	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
15	9606.ENSP00000299166	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
16	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
17	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
18	9606.ENSP00000317780	0.999	Cytochrome c oxidase subunit 5A, mitochondrial
19	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
20	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.842	catalytic activity
GO:0140104	0.671	molecular carrier activity
GO:0000036	0.363	acyl carrier activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044085	0.964	cellular component biogenesis
GO:0016043	0.958	cellular component organization
GO:0022607	0.931	cellular component assembly
GO:0031163	0.670	metallo-sulfur cluster assembly
GO:0006790	0.666	sulfur compound metabolic process
GO:0043933	0.655	protein-containing complex organization
GO:0007005	0.642	mitochondrion organization
GO:0006807	0.641	nitrogen compound metabolic process
GO:0016226	0.632	iron-sulfur cluster assembly
GO:0065003	0.583	protein-containing complex assembly
GO:0033108	0.537	mitochondrial respiratory chain complex assembly
GO:1901564	0.514	organonitrogen compound metabolic process
GO:0044281	0.511	small molecule metabolic process
GO:1901576	0.454	organic substance biosynthetic process
GO:0044249	0.453	cellular biosynthetic process
GO:0006091	0.383	generation of precursor metabolites and energy
GO:0019752	0.355	carboxylic acid metabolic process
GO:0043170	0.349	macromolecule metabolic process
GO:0032981	0.344	mitochondrial respiratory chain complex I assembly
GO:0009060	0.308	aerobic respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098798	1.000	mitochondrial protein-containing complex
GO:1990204	0.999	oxidoreductase complex
GO:0005759	0.999	mitochondrial matrix
GO:0098803	0.998	respiratory chain complex
GO:0005746	0.998	mitochondrial respirasome
GO:1990351	0.996	transporter complex
GO:1902495	0.994	transmembrane transporter complex
GO:0098800	0.989	inner mitochondrial membrane protein complex
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0030964	0.977	NADH dehydrogenase complex
GO:0005747	0.968	mitochondrial respiratory chain complex I
GO:0005634	0.930	nucleus
GO:0031981	0.788	nuclear lumen
GO:0005654	0.666	nucleoplasm
GO:1990904	0.426	ribonucleoprotein complex
GO:0015934	0.413	large ribosomal subunit
GO:0005762	0.391	mitochondrial large ribosomal subunit

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]