StarFunc result for job id O14562

User Input

>input (309 residues)
MAAAGAPDGMEEPGMDTEAETVATEAPARPVNCLEAEAAAGAAAEDSGAARGSLQPAPAQ
PPGDPAAQASVSNGEDAGGGAGRELVDLKIIWNKTKHDVKFPLDSTGSELKQKIHSITGL
PPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENK
KEPLCRQKQHRKVLDKGKPEDVMPSVKGAQERLPTVPLSGMYNKSGGKVRLTFKLEQDQL
WIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPTEASYYWVYWVPTQYVDAIKD
TVLGKWQYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14562	1.000	1.000	4.924E-55	309	1.000	1.000	O14562.pdb.gz	UBFD1_HUMAN Ubiquitin domain-containing protein UBFD1 OS=Homo sapiens OX=9606 GN=UBFD1 PE=1 SV=2
2	AFDB:Q556S4	0.258	0.201	6.955E-7	399	0.084	0.065	Q556S4.pdb.gz	Q556S4_DICDI protein-serine/threonine phosphatase OS=Dictyostelium discoideum OX=44689 GN=ublcp1-2 PE=4 SV=1
3	PDB:4rm8A	0.216	0.184	3.408E-6	368	0.120	0.101	4rm8A.pdb.gz
4	AFDB:D4A9A6	0.231	0.091	7.440E-6	820	0.117	0.044	D4A9A6.pdb.gz	D4A9A6_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
5	AFDB:J3QTA2	0.230	0.208	8.352E-6	345	0.107	0.096	J3QTA2.pdb.gz	J3QTA2_HUMAN BAG family molecular chaperone regulator 1 OS=Homo sapiens OX=9606 GN=BAG1 PE=1 SV=1
6	AFDB:Q0WUQ1	0.240	0.217	8.352E-6	342	0.084	0.076	Q0WUQ1.pdb.gz	BAG1_ARATH BAG family molecular chaperone regulator 1 OS=Arabidopsis thaliana OX=3702 GN=BAG1 PE=1 SV=1
7	AFDB:Q9JJP9	0.249	0.135	1.115E-5	582	0.078	0.041	Q9JJP9.pdb.gz	UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus OX=10116 GN=Ubqln1 PE=1 SV=1
8	AFDB:A0A3B3IU06	0.219	0.089	1.252E-5	807	0.113	0.043	A0A3B3IU06.pdb.gz	A0A3B3IU06_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
9	AFDB:Q8RX71	0.241	0.275	1.405E-5	269	0.055	0.063	Q8RX71.pdb.gz	BAG4_ARATH BAG family molecular chaperone regulator 4 OS=Arabidopsis thaliana OX=3702 GN=BAG4 PE=1 SV=1
10	AFDB:A0A2U3TZH6	0.219	0.086	1.671E-5	841	0.104	0.038	A0A2U3TZH6.pdb.gz	A0A2U3TZH6_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
11	PDB:3dbhI	0.235	0.785	2.045E-5	86	0.045	0.163	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
12	AFDB:A0A0G2K161	0.230	0.087	2.364E-5	866	0.110	0.039	A0A0G2K161.pdb.gz	A0A0G2K161_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
13	PDB:6yvaC	0.226	0.440	3.646E-5	155	0.055	0.110	6yvaC.pdb.gz
14	PDB:7rbsB	0.229	0.443	4.093E-5	157	0.036	0.070	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
15	PDB:4pyuA	0.226	0.850	6.134E-5	76	0.042	0.171	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
16	PDB:6mdhA	0.229	0.466	7.295E-5	149	0.023	0.047	6mdhA.pdb.gz
17	PDB:3ai5A	0.219	0.226	1.227E-4	299	0.039	0.040	3ai5A.pdb.gz
18	PDB:3plvA	0.224	0.811	1.227E-4	80	0.029	0.113	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
19	PDB:5xqmA	0.219	0.683	1.378E-4	90	0.036	0.122	5xqmA.pdb.gz
20	PDB:3pgeA	0.214	0.371	1.949E-4	172	0.036	0.064	3pgeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14562	0.0	634	309	1.000	1.000	UBFD1_HUMAN Ubiquitin domain-containing protein UBFD1 OS=Homo sapiens OX=9606 GN=UBFD1 PE=1 SV=2
2	Q92353	1.45e-04	45.4	468	0.071	0.047	UBP6_SCHPO Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp6 PE=1 SV=2
3	P54578	0.017	39.3	494	0.074	0.047	UBP14_HUMAN Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3
4	Q9JMA1	0.020	38.9	493	0.074	0.047	UBP14_MOUSE Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus OX=10090 GN=Usp14 PE=1 SV=3
5	Q0IIF7	0.026	38.5	494	0.074	0.047	UBP14_BOVIN Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos taurus OX=9913 GN=USP14 PE=2 SV=3
6	Q584D3	0.032	35.4	78	0.071	0.282	Q584D3_TRYB2 Ubiquitin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.1090 PE=1 SV=1
7	Q949Y0	0.057	37.4	482	0.058	0.037	UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana OX=3702 GN=UBP6 PE=1 SV=1
8	Q7KM13	0.23	35.4	425	0.100	0.073	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
9	Q9SII8	0.28	35.4	551	0.065	0.036	DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana OX=3702 GN=DSK2B PE=1 SV=1
10	P48510	0.45	34.7	373	0.058	0.048	DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSK2 PE=1 SV=2
11	O01761	0.60	34.7	8081	0.097	0.004	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
12	J3QTA2	0.70	33.9	345	0.061	0.055	J3QTA2_HUMAN BAG family molecular chaperone regulator 1 OS=Homo sapiens OX=9606 GN=BAG1 PE=1 SV=1
13	Q99933	0.70	33.9	345	0.061	0.055	BAG1_HUMAN BAG family molecular chaperone regulator 1 OS=Homo sapiens OX=9606 GN=BAG1 PE=1 SV=4
14	C9JYK5	0.76	32.7	150	0.061	0.127	C9JYK5_HUMAN BAG cochaperone 1 (Fragment) OS=Homo sapiens OX=9606 GN=BAG1 PE=1 SV=2
15	P13437	1.2	33.1	397	0.087	0.068	THIM_RAT 3-ketoacyl-CoA thiolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acaa2 PE=1 SV=1
16	Q9SII9	1.3	33.1	538	0.058	0.033	DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana OX=3702 GN=DSK2A PE=1 SV=2
17	Q9VEP9	1.5	33.1	784	0.061	0.024	Q9VEP9_DROME GH03554p OS=Drosophila melanogaster OX=7227 GN=Sf3a1 PE=1 SV=1
18	Q9VPD3	1.7	32.7	498	0.110	0.068	PTSS_DROME Phosphatidylserine synthase OS=Drosophila melanogaster OX=7227 GN=Pss PE=1 SV=1
19	Q15459	1.8	32.7	793	0.061	0.024	SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1
20	Q9VKZ8	1.8	32.7	475	0.061	0.040	Q9VKZ8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00240 ubiquitin	5.4e-10	50.2	Ubiquitin family
2	PF14560 Ubiquitin_2	0.12	24.2	Ubiquitin-like domain
3	PF18037 Ubiquitin_5	2.8e+02	13.2	Ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014635

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000001603	0.925	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
2	61853.ENSNLEP00000017278	0.922	Proteasome (prosome, macropain) 26S subunit, ATPase, 4
3	61853.ENSNLEP00000017781	0.919	Proteasome (prosome, macropain) 26S subunit, ATPase, 3
4	61853.ENSNLEP00000020685	0.918	Proteasome (prosome, macropain) 26S subunit, ATPase, 1
5	61853.ENSNLEP00000001750	0.914	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3
6	61853.ENSNLEP00000012370	0.911	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
7	61853.ENSNLEP00000011332	0.910	Proteasome (prosome, macropain) 26S subunit, ATPase, 2
8	61853.ENSNLEP00000015275	0.904	Proteasome (prosome, macropain) 26S subunit, ATPase, 6
9	61853.ENSNLEP00000018291	0.903	Proteasome endopeptidase complex
10	61853.ENSNLEP00000014388	0.895	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
11	61853.ENSNLEP00000005055	0.891	Proteasome (prosome, macropain) 26S subunit, ATPase, 5
12	61853.ENSNLEP00000007715	0.881	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
13	61853.ENSNLEP00000017031	0.875	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
14	61853.ENSNLEP00000006801	0.872	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
15	61853.ENSNLEP00000020499	0.872	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
16	61853.ENSNLEP00000019091	0.868	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
17	61853.ENSNLEP00000003464	0.857	Proteasome (prosome, macropain) subunit, alpha type, 5
18	61853.ENSNLEP00000000338	0.849	Proteasome (prosome, macropain) subunit, beta type, 1
19	61853.ENSNLEP00000007287	0.846	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
20	61853.ENSNLEP00000013474	0.845	Proteasome (prosome, macropain) subunit, beta type, 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.992	cellular process
GO:0008152	0.946	metabolic process
GO:0050794	0.946	regulation of cellular process
GO:0071704	0.941	organic substance metabolic process
GO:0044238	0.932	primary metabolic process
GO:0006807	0.923	nitrogen compound metabolic process
GO:0043170	0.814	macromolecule metabolic process
GO:0019222	0.801	regulation of metabolic process
GO:0044237	0.787	cellular metabolic process
GO:1901564	0.760	organonitrogen compound metabolic process
GO:0051171	0.760	regulation of nitrogen compound metabolic process
GO:0048518	0.750	positive regulation of biological process
GO:0060255	0.737	regulation of macromolecule metabolic process
GO:0071840	0.723	cellular component organization or biogenesis
GO:0031323	0.722	regulation of cellular metabolic process
GO:0080090	0.721	regulation of primary metabolic process
GO:0016043	0.694	cellular component organization
GO:0010468	0.636	regulation of gene expression
GO:0050896	0.568	response to stimulus
GO:0019538	0.536	protein metabolic process
GO:0051716	0.456	cellular response to stimulus
GO:0048522	0.429	positive regulation of cellular process
GO:0019219	0.345	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.325	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm
GO:0032991	0.994	protein-containing complex
GO:0043228	0.536	non-membrane-bounded organelle
GO:0043232	0.498	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]