StarFunc result for job id O14576

User Input

>input (645 residues)
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE
ALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPL
TRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE
EDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRV
IERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP
ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGT
YSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVF
EGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMW
SPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG
RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14576	1.000	1.000	0.000	645	1.000	1.000	O14576.pdb.gz	DC1I1_HUMAN Cytoplasmic dynein 1 intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1I1 PE=1 SV=2
2	AFDB:Q13409	0.761	0.769	5.376E-93	638	0.755	0.763	Q13409.pdb.gz	DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3
3	AFDB:Q24246	0.660	0.643	2.681E-70	663	0.485	0.472	Q24246.pdb.gz	DYIN_DROME Cytoplasmic dynein 1 intermediate chain OS=Drosophila melanogaster OX=7227 GN=sw PE=1 SV=3
4	AFDB:O45087	0.647	0.649	1.009E-57	643	0.367	0.369	O45087.pdb.gz	O45087_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dyci-1 PE=1 SV=1
5	PDB:6f1tp	0.525	0.829	1.396E-50	401	0.513	0.825	6f1tp.pdb.gz	Cryo-EM shows how dynactin recruits two dyneins for faster movement.
6	AFDB:M9NE47	0.475	0.634	1.415E-45	480	0.322	0.433	M9NE47.pdb.gz	M9NE47_DROME Sperm-specific dynein intermediate chain 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Sdic1 PE=3 SV=1
7	PDB:7kzmD	0.533	0.739	5.590E-28	456	0.144	0.204	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
8	PDB:6rlbD	0.502	0.713	1.503E-24	446	0.138	0.200	6rlbD.pdb.gz
9	PDB:7kzmE	0.493	0.657	6.256E-24	474	0.163	0.222	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.
10	AFDB:A0A0G2KIZ8	0.494	0.337	2.778E-23	968	0.184	0.123	A0A0G2KIZ8.pdb.gz	DNAI3_DANRE Dynein axonemal intermediate chain 3 OS=Danio rerio OX=7955 GN=dnai3 PE=2 SV=3
11	PDB:6rlbC	0.461	0.586	1.146E-20	494	0.130	0.170	6rlbC.pdb.gz
12	PDB:6zrdA	0.417	0.623	4.047E-20	411	0.090	0.141	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
13	PDB:3cfvB	0.428	0.671	7.398E-20	393	0.093	0.153	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
14	PDB:2ybaB	0.424	0.684	1.509E-19	382	0.091	0.154	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
15	AFDB:Q9UUG8	0.417	0.449	1.610E-19	598	0.141	0.152	Q9UUG8.pdb.gz	TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup12 PE=1 SV=2
16	PDB:3dm0A	0.428	0.409	4.050E-19	675	0.093	0.089	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
17	PDB:3w15A	0.436	0.811	5.043E-19	336	0.071	0.137	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
18	AFDB:P16649	0.387	0.352	9.333E-16	713	0.153	0.139	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
19	AFDB:Q7Z4S6	0.405	0.163	3.884E-15	1674	0.153	0.059	Q7Z4S6.pdb.gz	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
20	AFDB:Q9QXL1	0.402	0.163	6.721E-15	1668	0.143	0.055	Q9QXL1.pdb.gz	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F6H7	0.0	899	626	0.705	0.727	DCI2A_DANRE Dynein, cytoplasmic 1, intermediate chain 2a OS=Danio rerio OX=7955 GN=dync1i2a PE=3 SV=2
2	F1SF88	0.0	1115	622	0.901	0.934	F1SF88_PIG Dynein cytoplasmic 1 intermediate chain 1 OS=Sus scrofa OX=9823 GN=DYNC1I1 PE=1 SV=5
3	O14576	0.0	1346	645	1.000	1.000	DC1I1_HUMAN Cytoplasmic dynein 1 intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1I1 PE=1 SV=2
4	O88485	0.0	1278	628	0.955	0.981	DC1I1_MOUSE Cytoplasmic dynein 1 intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync1i1 PE=1 SV=2
5	O88487	0.0	884	612	0.722	0.761	DC1I2_MOUSE Cytoplasmic dynein 1 intermediate chain 2 OS=Mus musculus OX=10090 GN=Dync1i2 PE=1 SV=1
6	Q13409	0.0	950	638	0.763	0.771	DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3
7	Q24246	0.0	588	663	0.419	0.407	DYIN_DROME Cytoplasmic dynein 1 intermediate chain OS=Drosophila melanogaster OX=7227 GN=sw PE=1 SV=3
8	Q29RQ3	0.0	1223	608	0.926	0.982	DC1I1_BOVIN Cytoplasmic dynein 1 intermediate chain 1 OS=Bos taurus OX=9913 GN=DYNC1I1 PE=1 SV=1
9	Q62871	0.0	926	638	0.741	0.749	DC1I2_RAT Cytoplasmic dynein 1 intermediate chain 2 OS=Rattus norvegicus OX=10116 GN=Dync1i2 PE=1 SV=1
10	Q63100	0.0	1315	643	0.978	0.981	DC1I1_RAT Cytoplasmic dynein 1 intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1i1 PE=1 SV=1
11	Q9W5W4	1.93e-165	485	517	0.388	0.484	Q9W5W4_DROME Sperm-specific dynein intermediate chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Sdic1 PE=3 SV=2
12	M9NE47	1.50e-144	430	480	0.329	0.442	M9NE47_DROME Sperm-specific dynein intermediate chain 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Sdic1 PE=3 SV=1
13	O45087	9.88e-132	403	643	0.375	0.376	O45087_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dyci-1 PE=1 SV=1
14	P54703	1.09e-131	403	654	0.302	0.298	DYIN_DICDI Cytoplasmic dynein 1 intermediate chain OS=Dictyostelium discoideum OX=44689 GN=dicA PE=2 SV=2
15	Q5BDC6	1.12e-113	358	689	0.319	0.299	Q5BDC6_EMENI Cytoplasmic dynein intermediate chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudI PE=4 SV=1
16	O94518	1.41e-45	172	544	0.188	0.222	DIC1_SCHPO Dynein intermediate chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dic1 PE=1 SV=2
17	F1QHZ6	4.32e-29	125	778	0.133	0.111	DNAI4_DANRE Dynein axonemal intermediate chain 4 OS=Danio rerio OX=7955 GN=dnai4 PE=2 SV=1
18	Q385R8	5.85e-29	124	655	0.164	0.162	Q385R8_TRYB2 Dynein intermediate chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2640 PE=4 SV=1
19	Q6GPB9	4.10e-28	122	742	0.166	0.144	DNAI4_XENLA Dynein axonemal intermediate chain 4 OS=Xenopus laevis OX=8355 GN=dnai4 PE=2 SV=1
20	A0A286ZPL5	1.06e-26	117	704	0.135	0.124	A0A286ZPL5_PIG Dynein axonemal intermediate chain 1 OS=Sus scrofa OX=9823 GN=DNAI1 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11540 Dynein_IC2	8.2e-11	52.9	Cytoplasmic dynein 1 intermediate chain 2
2	PF00300 His_Phos_1	2.6e+02	12.7	Histidine phosphatase superfamily (branch 1)
3	PF00400 WD40	0.0015	30.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348965	0.996	Cytoplasmic dynein 1 heavy chain 1
2	9606.ENSP00000354791	0.994	Dynactin subunit 1
3	9606.ENSP00000376297	0.994	Dynein light chain 1, cytoplasmic
4	9606.ENSP00000273130	0.992	Cytoplasmic dynein 1 light intermediate chain 1
5	9606.ENSP00000349679	0.990	Dynein light chain roadblock-type 1
6	9606.ENSP00000258198	0.989	Cytoplasmic dynein 1 light intermediate chain 2
7	9606.ENSP00000477310	0.978	Dynein light chain 2, cytoplasmic
8	9606.ENSP00000302936	0.976	Dynein light chain roadblock-type 2
9	9606.ENSP00000356056	0.972	Dynein light chain Tctex-type 1
10	9606.ENSP00000367841	0.961	Dynein light chain Tctex-type 3
11	9606.ENSP00000380378	0.947	Platelet-activating factor acetylhydrolase IB subunit alpha
12	9606.ENSP00000349351	0.941	Protein bicaudal D homolog 2
13	9606.ENSP00000380308	0.934	Cytoplasmic dynein 1 intermediate chain 2
14	9606.ENSP00000474032	0.933	Cytoplasmic dynein 2 light intermediate chain 1
15	9606.ENSP00000347626	0.929	NudC domain containing 3
16	9606.ENSP00000482075	0.925	Prostaglandin E synthase 3
17	9606.ENSP00000001008	0.917	Peptidyl-prolyl cis-trans isomerase FKBP4
18	9606.ENSP00000381167	0.915	Cytoplasmic dynein 2 heavy chain 1
19	9606.ENSP00000231509	0.914	Glucocorticoid receptor
20	9606.ENSP00000335153	0.910	Heat shock protein HSP 90-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.301	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051234	0.990	establishment of localization
GO:0051641	0.990	cellular localization
GO:0030705	0.979	cytoskeleton-dependent intracellular transport
GO:0099111	0.978	microtubule-based transport
GO:0010970	0.957	transport along microtubule
GO:0051656	0.919	establishment of organelle localization
GO:0051648	0.835	vesicle localization
GO:0051650	0.787	establishment of vesicle localization
GO:0072384	0.784	organelle transport along microtubule
GO:0099518	0.594	vesicle cytoskeletal trafficking
GO:0050789	0.546	regulation of biological process
GO:0047496	0.524	vesicle transport along microtubule
GO:0050794	0.464	regulation of cellular process
GO:0071840	0.409	cellular component organization or biogenesis
GO:0016043	0.371	cellular component organization
GO:0032501	0.325	multicellular organismal process
GO:0048856	0.321	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0005875	0.998	microtubule associated complex
GO:0030286	0.987	dynein complex
GO:0005868	0.973	cytoplasmic dynein complex
GO:0043231	0.924	intracellular membrane-bounded organelle
GO:0005829	0.913	cytosol
GO:0005634	0.739	nucleus
GO:0012505	0.592	endomembrane system
GO:0031982	0.493	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]