StarFunc result for job id O14578

User Input

>input (2027 residues)
MLKFKYGARNPLDAGAAEPIASRASRLNLFFQGKPPFMTQQQMSPLSREGILDALFVLFE
ECSQPALMKIKHVSNFVRKYSDTIAELQELQPSAKDFEVRSLVGCGHFAEVQVVREKATG
DIYAMKVMKKKALLAQEQVSFFEEERNILSRSTSPWIPQLQYAFQDKNHLYLVMEYQPGG
DLLSLLNRYEDQLDENLIQFYLAELILAVHSVHLMGYVHRDIKPENILVDRTGHIKLVDF
GSAAKMNSNKMVNAKLPIGTPDYMAPEVLTVMNGDGKGTYGLDCDWWSVGVIAYEMIYGR
SPFAEGTSARTFNNIMNFQRFLKFPDDPKVSSDFLDLIQSLLCGQKERLKFEGLCCHPFF
SKIDWNNIRNSPPPFVPTLKSDDDTSNFDEPEKNSWVSSSPCQLSPSGFSGEELPFVGFS
YSKALGILGRSESVVSGLDSPAKTSSMEKKLLIKSKELQDSQDKCHKMEQEMTRLHRRVS
EVEAVLSQKEVELKASETQRSLLEQDLATYITECSSLKRSLEQARMEVSQEDDKALQLLH
DIREQSRKLQEIKEQEYQAQVEEMRLMMNQLEEDLVSARRRSDLYESELRESRLAAEEFK
RKATECQHKLLKAKDQGKPEVGEYAKLEKINAEQQLKIQELQEKLEKAVKASTEATELLQ
NIRQAKERAERELEKLQNREDSSEGIRKKLVEAEELEEKHREAQVSAQHLEVHLKQKEQH
YEEKIKVLDNQIKKDLADKETLENMMQRHEEEAHEKGKILSEQKAMINAMDSKIRSLEQR
IVELSEANKLAANSSLFTQRNMKAQEEMISELRQQKFYLETQAGKLEAQNRKLEEQLEKI
SHQDHSDKNRLLELETRLREVSLEHEEQKLELKRQLTELQLSLQERESQLTALQAARAAL
ESQLRQAKTELEETTAEAEEEIQALTAHRDEIQRKFDALRNSCTVITDLEEQLNQLTEDN
AELNNQNFYLSKQLDEASGANDEIVQLRSEVDHLRREITEREMQLTSQKQTMEALKTTCT
MLEEQVMDLEALNDELLEKERQWEAWRSVLGDEKSQFECRVRELQRMLDTEKQSRARADQ
RITESRQVVELAVKEHKAEILALQQALKEQKLKAESLSDKLNDLEKKHAMLEMNARSLQQ
KLETERELKQRLLEEQAKLQQQMDLQKNHIFRLTQGLQEALDRADLLKTERSDLEYQLEN
IQVLYSHEKVKMEGTISQQTKLIDFLQAKMDQPAKKKKGLFSRRKEDPALPTQVPLQYNE
LKLALEKEKARCAELEEALQKTRIELRSAREEAAHRKATDHPHPSTPATARQQIAMSAIV
RSPEHQPSAMSLLAPPSSRRKESSTPEEFSRRLKERMHHNIPHRFNVGLNMRATKCAVCL
DTVHFGRQASKCLECQVMCHPKCSTCLPATCGLPAEYATHFTEAFCRDKMNSPGLQTKEP
SSSLHLEGWMKVPRNNKRGQQGWDRKYIVLEGSKVLIYDNEAREAGQRPVEEFELCLPDG
DVSIHGAVGASELANTAKADVPYILKMESHPHTTCWPGRTLYLLAPSFPDKQRWVTALES
VVAGGRVSREKAEADAKLLGNSLLKLEGDDRLDMNCTLPFSDQVVLVGTEEGLYALNVLK
NSLTHVPGIGAVFQIYIIKDLEKLLMIAGEERALCLVDVKKVKQSLAQSHLPAQPDISPN
IFEAVKGCHLFGAGKIENGLCICAAMPSKVVILRYNENLSKYCIRKEIETSEPCSCIHFT
NYSILIGTNKFYEIDMKQYTLEEFLDKNDHSLAPAVFAASSNSFPVSIVQVNSAGQREEY
LLCFHEFGVFVDSYGRRSRTDDLKWSRLPLAFAYREPYLFVTHFNSLEVIEIQARSSAGT
PARAYLDIPNPRYLGPAISSGAIYLASSYQDKLRVICCKGNLVKESGTEHHRGPSTSRSS
PNKRGPPTYNEHITKRVASSPAPPEGPSHPREPSTPHRYREGRTELRRDKSPGRPLEREK
SPGRMLSTRRERSPGRLFEDSSRGRLPAGAVRTPLSQVNKVWDQSSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14578	1.000	1.000	0.000	2027	1.000	1.000	O14578.pdb.gz	CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2
2	AFDB:Q9W1B0	0.218	0.267	2.161E-76	1637	0.204	0.252	Q9W1B0.pdb.gz	GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1
3	AFDB:O54874	0.207	0.238	2.508E-76	1732	0.230	0.270	O54874.pdb.gz	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
4	AFDB:Q7TT49	0.207	0.242	2.424E-74	1713	0.221	0.261	Q7TT49.pdb.gz	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
5	AFDB:Q6DT37	0.191	0.248	2.678E-74	1551	0.205	0.268	Q6DT37.pdb.gz	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
6	AFDB:M9PI41	0.184	0.200	3.433E-74	1858	0.235	0.256	M9PI41.pdb.gz	M9PI41_DROME Sticky, isoform B OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=1
7	AFDB:O01583	0.200	0.251	3.371E-70	1592	0.199	0.253	O01583.pdb.gz	MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans OX=6239 GN=mrck-1 PE=1 SV=3
8	AFDB:M3TYT0	0.194	0.282	1.813E-51	1388	0.170	0.248	M3TYT0.pdb.gz	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
9	AFDB:A0A0R4IHT4	0.197	0.284	4.014E-51	1396	0.171	0.248	A0A0R4IHT4.pdb.gz
10	AFDB:P92199	0.192	0.327	2.828E-45	1173	0.148	0.256	P92199.pdb.gz	ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans OX=6239 GN=let-502 PE=1 SV=1
11	PDB:6byrA	0.143	0.686	5.950E-26	405	0.062	0.309	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:5x3fB	0.130	0.703	9.294E-23	349	0.049	0.287	5x3fB.pdb.gz
13	PDB:3c4wB	0.141	0.530	8.273E-22	519	0.056	0.218	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
14	PDB:6pjxA	0.148	0.518	9.138E-22	543	0.053	0.199	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
15	PDB:4mk0A	0.145	0.448	1.294E-21	631	0.052	0.168	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:3pvuA	0.133	0.422	1.743E-21	609	0.052	0.172	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:5dykA	0.129	0.317	3.673E-21	809	0.049	0.124	5dykA.pdb.gz
18	PDB:4yhjA	0.132	0.508	5.466E-21	501	0.050	0.204	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
19	PDB:3nynA	0.140	0.486	5.745E-21	554	0.051	0.186	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
20	PDB:3pfqA	0.130	0.490	2.817E-20	523	0.045	0.174	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PSL7	0.0	3966	2055	0.959	0.945	CTRO_RAT Citron rho-interacting kinase OS=Rattus norvegicus OX=10116 GN=Cit PE=1 SV=1
2	O14578	0.0	4188	2027	1.000	1.000	CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2
3	O88527	0.0	879	448	0.202	0.913	O88527_RAT Citron-K kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
4	P49025	0.0	3950	2055	0.960	0.946	CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus OX=10090 GN=Cit PE=1 SV=3
5	Q9VTY8	2.02e-127	446	1854	0.213	0.232	Q9VTY8_DROME FI02033p OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=2
6	M9PI41	4.27e-126	442	1858	0.214	0.233	M9PI41_DROME Sticky, isoform B OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=1
7	O01583	1.95e-109	388	1592	0.135	0.171	MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans OX=6239 GN=mrck-1 PE=1 SV=3
8	Q86XZ8	3.47e-109	360	492	0.095	0.390	Q86XZ8_HUMAN CDC42BPB protein (Fragment) OS=Homo sapiens OX=9606 GN=CDC42BPB PE=2 SV=1
9	P92199	1.95e-108	378	1173	0.128	0.222	ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans OX=6239 GN=let-502 PE=1 SV=1
10	A0A0R4IVY5	2.12e-107	379	1359	0.148	0.220	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
11	Q3UU96	2.31e-107	383	1719	0.140	0.165	MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2
12	Q6DT37	3.90e-107	381	1551	0.128	0.167	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
13	A0A2P9DU05	5.93e-107	378	1388	0.156	0.228	A0A2P9DU05_HUMAN Rho-associated protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=2 SV=1
14	O75116	5.93e-107	378	1388	0.156	0.228	ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4
15	O54874	8.22e-107	382	1732	0.138	0.162	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
16	Q28021	8.24e-106	374	1388	0.153	0.223	ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus OX=9913 GN=ROCK2 PE=1 SV=1
17	Q9Y5S2	1.53e-105	377	1711	0.134	0.158	MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2
18	Q7TT49	3.44e-105	376	1713	0.135	0.160	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
19	M3TYT0	3.50e-105	372	1388	0.154	0.226	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
20	P70335	5.51e-105	371	1354	0.141	0.210	ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Rock1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	2.4e+02	13.0	Phosphotransferase enzyme family
2	PF00130 C1_1	0.082	24.1	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF00780 CNH	2.4e-62	222.6	CNH domain
4	PF00169 PH	3.6e-07	42.0	PH domain
5	PF00069 Pkinase	3.6e-56	202.0	Protein kinase domain
6	PF00433 Pkinase_C	2.5	20.2	Protein kinase C terminal domain
7	PF07714 PK_Tyr_Ser-Thr	6.4e-25	99.5	Protein tyrosine and serine/threonine kinase
8	PF07387 Seadorna_VP7	5.3	17.6	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000009370

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000051373	0.941	Probable role in mitotic spindle regulation and coordination of mitotic processes. May have a preferential role in regulating neurogenesis (By similarity)
2	9598.ENSPTRP00000012362	0.928	Kinesin-like protein
3	9598.ENSPTRP00000032604	0.917	Anillin, actin binding protein
4	9598.ENSPTRP00000029552	0.909	Kinesin-like protein
5	9598.ENSPTRP00000025759	0.895	Ras homolog family member A
6	9598.ENSPTRP00000003041	0.892	Uncharacterized protein
7	9598.ENSPTRP00000004812	0.876	Kinesin family member 11
8	9598.ENSPTRP00000044771	0.860	Uncharacterized protein
9	9598.ENSPTRP00000001916	0.854	Ras homolog gene family, member C
10	9598.ENSPTRP00000043912	0.854	Protein regulator of cytokinesis 1
11	9598.ENSPTRP00000033436	0.835	Uncharacterized protein
12	9598.ENSPTRP00000025092	0.812	SH3 and multiple ankyrin repeat domains 3
13	9598.ENSPTRP00000007646	0.809	Rho GTPase activating protein 32
14	9598.ENSPTRP00000016741	0.793	Uncharacterized protein
15	9598.ENSPTRP00000023100	0.793	Myosin, light chain 9, regulatory
16	9598.ENSPTRP00000037806	0.792	Kinesin family member 4A
17	9598.ENSPTRP00000004634	0.781	Discs, large homolog 5 (Drosophila)
18	9598.ENSPTRP00000000548	0.769	Cell division cycle 42 (GTP binding protein, 25kDa)
19	9598.ENSPTRP00000013669	0.769	Myosin light chain, phosphorylatable, fast skeletal muscle
20	9598.ENSPTRP00000016740	0.769	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0004674	0.993	protein serine/threonine kinase activity
GO:0019901	0.957	protein kinase binding
GO:0035639	0.832	purine ribonucleoside triphosphate binding
GO:0032555	0.825	purine ribonucleotide binding
GO:0005524	0.769	ATP binding
GO:0019904	0.646	protein domain specific binding
GO:0030165	0.568	PDZ domain binding
GO:0097110	0.320	scaffold protein binding
GO:0030291	0.306	protein serine/threonine kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0007049	0.963	cell cycle
GO:0071840	0.928	cellular component organization or biogenesis
GO:0032501	0.926	multicellular organismal process
GO:0022402	0.924	cell cycle process
GO:0016043	0.920	cellular component organization
GO:0000278	0.903	mitotic cell cycle
GO:0032502	0.839	developmental process
GO:0050896	0.814	response to stimulus
GO:0048856	0.790	anatomical structure development
GO:0051726	0.743	regulation of cell cycle
GO:0051128	0.727	regulation of cellular component organization
GO:0006996	0.726	organelle organization
GO:0048523	0.725	negative regulation of cellular process
GO:0051716	0.702	cellular response to stimulus
GO:0023052	0.700	signaling
GO:0007154	0.700	cell communication
GO:0007275	0.699	multicellular organism development
GO:0048518	0.698	positive regulation of biological process
GO:0048583	0.681	regulation of response to stimulus
GO:0007165	0.679	signal transduction
GO:0048522	0.678	positive regulation of cellular process
GO:0023051	0.677	regulation of signaling
GO:0010646	0.676	regulation of cell communication
GO:0009966	0.662	regulation of signal transduction
GO:1903047	0.622	mitotic cell cycle process
GO:0048731	0.600	system development
GO:1902531	0.534	regulation of intracellular signal transduction
GO:0033043	0.516	regulation of organelle organization
GO:0065008	0.470	regulation of biological quality
GO:0050793	0.418	regulation of developmental process
GO:0035556	0.401	intracellular signal transduction
GO:0008152	0.354	metabolic process
GO:0048869	0.354	cellular developmental process
GO:0030154	0.339	cell differentiation
GO:0007010	0.327	cytoskeleton organization
GO:0010564	0.324	regulation of cell cycle process
GO:0071704	0.302	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.966	membrane
GO:0043226	0.648	organelle
GO:0043229	0.633	intracellular organelle
GO:0043227	0.626	membrane-bounded organelle
GO:0071944	0.502	cell periphery
GO:0043228	0.415	non-membrane-bounded organelle
GO:0043231	0.415	intracellular membrane-bounded organelle
GO:0043232	0.410	intracellular non-membrane-bounded organelle
GO:0005886	0.324	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.994	Phosphotransferases with an alcohol group as acceptor.

[back to server]