StarFunc result for job id O14579

User Input

>input (308 residues)
MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAY
LAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFL
LMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDAT
LTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQ
EALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRL
VLQYAPSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14579	1.000	1.000	1.311E-39	308	1.000	1.000	O14579.pdb.gz	COPE_HUMAN Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE PE=1 SV=3
2	AFDB:M0QXB4	0.962	0.896	3.107E-37	331	0.990	0.921	M0QXB4.pdb.gz	M0QXB4_HUMAN Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE PE=1 SV=1
3	PDB:5a1vQ	0.943	0.994	1.096E-32	292	0.864	0.911	5a1vQ.pdb.gz
4	AFDB:Q9SA78	0.914	0.963	3.084E-20	292	0.393	0.414	Q9SA78.pdb.gz	COPE1_ARATH Coatomer subunit epsilon-1 OS=Arabidopsis thaliana OX=3702 GN=At1g30630 PE=2 SV=1
5	AFDB:O62246	0.885	0.932	7.309E-18	292	0.347	0.366	O62246.pdb.gz	COPE_CAEEL Coatomer subunit epsilon OS=Caenorhabditis elegans OX=6239 GN=cope-1 PE=3 SV=1
6	AFDB:Q9Y0Y5	0.879	0.885	2.144E-17	306	0.357	0.359	Q9Y0Y5.pdb.gz	Q9Y0Y5_DROME Coatomer subunit epsilon OS=Drosophila melanogaster OX=7227 GN=epsilonCOP PE=1 SV=1
7	AFDB:Q381U5	0.851	0.812	5.314E-13	324	0.269	0.256	Q381U5.pdb.gz	Q381U5_TRYB2 Coatomer subunit epsilon OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6530 PE=3 SV=1
8	AFDB:O74767	0.756	0.804	4.784E-10	288	0.240	0.257	O74767.pdb.gz	COPE_SCHPO Probable coatomer subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec28 PE=1 SV=1
9	AFDB:P40509	0.740	0.767	1.633E-8	296	0.195	0.203	P40509.pdb.gz	COPE_YEAST Coatomer subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC28 PE=1 SV=2
10	PDB:3mv2B	0.722	0.755	1.005E-7	293	0.198	0.208	3mv2B.pdb.gz
11	AFDB:Q382T6	0.501	0.298	5.953E-6	568	0.166	0.090	Q382T6.pdb.gz	Q382T6_TRYB2 Bardet-Biedl syndrome 8 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4290 PE=4 SV=1
12	AFDB:Q38AS4	0.488	0.342	1.136E-5	466	0.146	0.097	Q38AS4.pdb.gz	Q38AS4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3940 PE=4 SV=1
13	PDB:7qe7K	0.583	0.369	6.990E-5	531	0.130	0.075	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:7qe7Y	0.411	0.293	7.619E-5	502	0.123	0.076	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:7qe7J	0.619	0.404	1.277E-4	510	0.146	0.088	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:6bq1B	0.562	0.268	1.882E-4	728	0.123	0.052	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
17	PDB:6tedQ	0.493	0.204	2.235E-4	890	0.172	0.060	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
18	PDB:2y4uA	0.329	0.243	3.154E-4	424	0.143	0.104	2y4uA.pdb.gz
19	PDB:8a3tJ	0.600	0.392	3.154E-4	509	0.136	0.083	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:5dseA	0.549	0.341	3.293E-4	537	0.120	0.069	5dseA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0QXB4	0.0	619	331	0.997	0.927	M0QXB4_HUMAN Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE PE=1 SV=1
2	O14579	0.0	636	308	1.000	1.000	COPE_HUMAN Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE PE=1 SV=3
3	O89079	0.0	588	308	0.906	0.906	COPE_MOUSE Coatomer subunit epsilon OS=Mus musculus OX=10090 GN=Cope PE=1 SV=3
4	Q28104	0.0	605	308	0.942	0.942	COPE_BOVIN Coatomer subunit epsilon OS=Bos taurus OX=9913 GN=COPE PE=1 SV=3
5	Q9SA78	8.43e-78	241	292	0.396	0.418	COPE1_ARATH Coatomer subunit epsilon-1 OS=Arabidopsis thaliana OX=3702 GN=At1g30630 PE=2 SV=1
6	Q9Y0Y5	1.43e-60	197	306	0.364	0.366	Q9Y0Y5_DROME Coatomer subunit epsilon OS=Drosophila melanogaster OX=7227 GN=epsilonCOP PE=1 SV=1
7	O62246	9.56e-56	184	292	0.344	0.363	COPE_CAEEL Coatomer subunit epsilon OS=Caenorhabditis elegans OX=6239 GN=cope-1 PE=3 SV=1
8	Q381U5	6.44e-18	84.7	324	0.256	0.244	Q381U5_TRYB2 Coatomer subunit epsilon OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6530 PE=3 SV=1
9	O74767	2.26e-12	68.6	288	0.250	0.267	COPE_SCHPO Probable coatomer subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec28 PE=1 SV=1
10	P40509	6.49e-04	43.1	296	0.234	0.243	COPE_YEAST Coatomer subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC28 PE=1 SV=2
11	Q9LQ14	8.22e-04	43.1	629	0.133	0.065	PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g62930 PE=2 SV=2
12	Q9SXD1	0.081	37.0	630	0.140	0.068	PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g62670 PE=3 SV=2
13	Q9SZ52	0.099	37.0	1112	0.075	0.021	PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGR3 PE=1 SV=1
14	Q9SA76	0.50	34.7	1006	0.127	0.039	PPR64_ARATH Pentatricopeptide repeat-containing protein At1g30610, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB2279 PE=3 SV=1
15	Q9SR00	0.55	34.3	602	0.127	0.065	PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g04760 PE=2 SV=1
16	Q4GZ84	2.3	32.3	886	0.114	0.040	Q4GZ84_TRYB2 Kinesin-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1350 PE=3 SV=1
17	Q9FJW6	2.5	32.3	798	0.065	0.025	PP451_ARATH Pentatricopeptide repeat-containing protein At5g67570, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DG1 PE=1 SV=2
18	F4IP13	3.2	32.0	1716	0.107	0.019	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
19	O14217	5.2	31.2	625	0.062	0.030	TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tom70 PE=1 SV=1
20	Q3MK94	5.5	31.2	428	0.052	0.037	ECT1_ARATH YTH domain-containing protein ECT1 OS=Arabidopsis thaliana OX=3702 GN=ECT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	1.1	20.9	Anaphase-promoting complex, cyclosome, subunit 3
2	PF04733 Coatomer_E	4.9e-129	441.5	Coatomer epsilon subunit
3	PF06133 Com_YlbF	5e+02	12.7	Control of competence regulator ComK, YlbF/YmcA
4	PF10414 CysG_dimeriser	57	14.9	Sirohaem synthase dimerisation region
5	PF07219 HemY_N	15	17.1	HemY protein N-terminus
6	PF00515 TPR_1	63	14.8	Tetratricopeptide repeat
7	PF13424 TPR_12	0.35	22.5	Tetratricopeptide repeat
8	PF13428 TPR_14	0.0064	28.2	Tetratricopeptide repeat
9	PF13432 TPR_16	4.8	19.1	Tetratricopeptide repeat
10	PF14559 TPR_19	0.00094	30.9	Tetratricopeptide repeat
11	PF07719 TPR_2	0.53	21.6	Tetratricopeptide repeat
12	PF07721 TPR_4	1.5e+02	14.4	Tetratricopeptide repeat
13	PF13174 TPR_6	8.5e+02	12.1	Tetratricopeptide repeat
14	PF13176 TPR_7	45	15.5	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249923	0.999	Coatomer subunit beta
2	9606.ENSP00000264028	0.999	Coatomer subunit delta
3	9606.ENSP00000329419	0.999	Coatomer subunit beta
4	9606.ENSP00000357048	0.999	Coatomer subunit alpha
5	9606.ENSP00000449270	0.999	Coatomer subunit zeta-1
6	9606.ENSP00000325002	0.995	Coatomer subunit gamma-1
7	9606.ENSP00000402346	0.995	Coatomer subunit gamma-2
8	9606.ENSP00000480707	0.970	Coatomer subunit zeta-2
9	9606.ENSP00000373312	0.946	Protein SEC13 homolog
10	9606.ENSP00000483688	0.940	Proteasome subunit beta type-3
11	9606.ENSP00000440005	0.924	ADP-ribosylation factor 1
12	9606.ENSP00000270176	0.903	N-terminal kinase-like protein
13	9606.ENSP00000303145	0.901	Transmembrane emp24 domain-containing protein 10
14	9606.ENSP00000314615	0.899	ADP-ribosylation factor GTPase-activating protein 1
15	9606.ENSP00000329471	0.812	ER lumen protein-retaining receptor 1
16	9606.ENSP00000222547	0.802	BET1 homolog
17	9606.ENSP00000263245	0.799	ADP-ribosylation factor GTPase-activating protein 3
18	9606.ENSP00000434442	0.794	ADP-ribosylation factor GTPase-activating protein 2
19	9606.ENSP00000317780	0.792	Cytochrome c oxidase subunit 5A, mitochondrial
20	9606.ENSP00000416097	0.792	Golgin subfamily A member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.995	localization
GO:0006810	0.988	transport
GO:0009987	0.928	cellular process
GO:0048193	0.896	Golgi vesicle transport
GO:0051641	0.651	cellular localization
GO:0033036	0.533	macromolecule localization
GO:0006890	0.501	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006891	0.485	intra-Golgi vesicle-mediated transport
GO:0008104	0.388	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.998	Golgi apparatus
GO:0031090	0.996	organelle membrane
GO:0097708	0.996	intracellular vesicle
GO:0032991	0.995	protein-containing complex
GO:0070013	0.995	intracellular organelle lumen
GO:0031410	0.992	cytoplasmic vesicle
GO:0098588	0.990	bounding membrane of organelle
GO:0005654	0.983	nucleoplasm
GO:0030659	0.971	cytoplasmic vesicle membrane
GO:0030135	0.968	coated vesicle
GO:0005829	0.930	cytosol
GO:0005789	0.911	endoplasmic reticulum membrane
GO:0005798	0.895	Golgi-associated vesicle
GO:0000139	0.864	Golgi membrane
GO:0030133	0.821	transport vesicle
GO:0098796	0.761	membrane protein complex
GO:0030137	0.741	COPI-coated vesicle
GO:0030662	0.699	coated vesicle membrane
GO:0005576	0.377	extracellular region
GO:0030660	0.367	Golgi-associated vesicle membrane
GO:0071944	0.361	cell periphery
GO:1903561	0.351	extracellular vesicle
GO:0030663	0.341	COPI-coated vesicle membrane
GO:0030120	0.335	vesicle coat
GO:0005886	0.303	plasma membrane
GO:0030126	0.303	COPI vesicle coat

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]