StarFunc result for job id O14594

User Input

>input (1321 residues)
MGAPFVWALGLLMLQMLLFVAGEQGTQDITDASERGLHMQKLGSGSVQAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRR
ANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQE
ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHH
PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEETLILE
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPMPRRR
GRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSP
WADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATP
DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAH
GEATATAPPSPAAETKVYSLPLSLTPTGQGGEAMPTTPESPRADFRETGETSPAQVNKAE
HSSSSPWPSVNRNVAVGFVPTETATEPTGLRGIPGSESGVFDTAESPTSGLQATVDEVQD
PWPSVYSKGLDASSPSAPLGSPGVFLVPKVTPNLEPWVATDEGPTVNPMDSTVTPAPSDA
SGIWEPGSQVFEEAESTTLSPQVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQPHPE
PEDQVETQGTSGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLL
PVTLGIEDFELEVLAGSPGVESFWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHG
GTCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSF
CEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRSGHLTSVHSPEEHSFINSFGH
ENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPC
NYNLPYVCKKGTVLCGPPPAVENASLIGARKAKYNVHATVRYQCNEGFAQHHVATIRCRS
NGKWDRPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPTEDWEKDEGNF
C

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14594	0.999	0.999	0.000	1321	1.000	1.000	O14594.pdb.gz	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
2	AFDB:P55066	0.295	0.307	0.000	1268	0.668	0.696	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
3	AFDB:A0A2R8QK78	0.243	0.205	1.225E-83	1570	0.343	0.289	A0A2R8QK78.pdb.gz
4	AFDB:A0A2R8Q3K1	0.229	0.469	1.740E-67	635	0.235	0.488	A0A2R8Q3K1.pdb.gz	A0A2R8Q3K1_DANRE Chondroitin sulfate proteoglycan 2 OS=Danio rerio OX=7955 GN=br146 PE=4 SV=1
5	AFDB:Q86W61	0.241	0.878	2.600E-44	354	0.125	0.466	Q86W61.pdb.gz	Q86W61_HUMAN VCAN protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=1
6	PDB:1qddA	0.091	0.775	6.098E-9	144	0.031	0.285	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
7	PDB:5f2qB	0.090	0.803	6.098E-9	135	0.033	0.319	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
8	PDB:4mthA	0.090	0.769	1.136E-7	139	0.033	0.317	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
9	PDB:1htnA	0.086	0.688	2.746E-7	156	0.026	0.224	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
10	PDB:1gz2A	0.088	0.769	2.902E-7	139	0.030	0.281	1gz2A.pdb.gz
11	PDB:3oaiA	0.079	0.205	3.067E-7	488	0.018	0.049	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:7wz8A	0.089	0.607	3.067E-7	180	0.031	0.228	7wz8A.pdb.gz
13	PDB:4adfM	0.075	0.451	3.241E-7	191	0.023	0.162	4adfM.pdb.gz
14	PDB:3bx4C	0.075	0.666	3.824E-7	134	0.028	0.276	3bx4C.pdb.gz
15	PDB:1bj3A	0.072	0.669	8.751E-7	129	0.029	0.295	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
16	AFDB:Q9ULI3	0.054	0.052	3.308E-6	1381	0.118	0.113	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
17	AFDB:Q3V1M1	0.071	0.039	8.933E-6	2594	0.116	0.059	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
18	AFDB:Q90X22	0.077	0.079	2.449E-4	1276	0.095	0.099	Q90X22.pdb.gz
19	AFDB:E9Q7X6	0.055	0.055	3.227E-4	1337	0.122	0.120	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
20	AFDB:Q6WRI0	0.082	0.046	7.383E-4	2623	0.130	0.066	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14594	0.0	2711	1321	1.000	1.000	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
2	P55066	0.0	1610	1268	0.671	0.700	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
3	P55067	0.0	1585	1257	0.664	0.698	NCAN_RAT Neurocan core protein OS=Rattus norvegicus OX=10116 GN=Ncan PE=1 SV=1
4	Q62059	5.99e-114	398	3357	0.120	0.047	CSPG2_MOUSE Versican core protein OS=Mus musculus OX=10090 GN=Vcan PE=1 SV=2
5	P13611	1.30e-113	397	3396	0.121	0.047	CSPG2_HUMAN Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3
6	Q9ERB4	2.49e-113	396	2738	0.120	0.058	CSPG2_RAT Versican core protein (Fragments) OS=Rattus norvegicus OX=10116 GN=Vcan PE=2 SV=2
7	F1SX59	8.73e-113	395	3382	0.120	0.047	F1SX59_PIG Versican OS=Sus scrofa OX=9823 GN=VCAN PE=2 SV=1
8	Q75ZI3	5.71e-112	388	1570	0.117	0.099	Q75ZI3_DANRE Dermacan OS=Danio rerio OX=7955 GN=dcan PE=1 SV=1
9	A0A2R8Q3K1	5.75e-110	362	635	0.123	0.257	A0A2R8Q3K1_DANRE Chondroitin sulfate proteoglycan 2 OS=Danio rerio OX=7955 GN=br146 PE=4 SV=1
10	Q86W61	3.09e-102	331	354	0.123	0.460	Q86W61_HUMAN VCAN protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=1
11	Q29011	3.57e-100	332	537	0.120	0.296	PGCA_PIG Aggrecan core protein (Fragments) OS=Sus scrofa OX=9823 GN=ACAN PE=1 SV=3
12	A4JYN2	2.67e-97	342	1295	0.123	0.125	A4JYN2_DANRE Bcan OS=Danio rerio OX=7955 GN=fi32a12 PE=1 SV=1
13	P16112	4.14e-96	343	2530	0.122	0.064	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3
14	Q61282	9.87e-96	342	2132	0.121	0.075	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
15	P07897	2.87e-95	341	2124	0.121	0.075	PGCA_RAT Aggrecan core protein OS=Rattus norvegicus OX=10116 GN=Acan PE=1 SV=2
16	P13608	3.20e-95	341	2364	0.109	0.061	PGCA_BOVIN Aggrecan core protein OS=Bos taurus OX=9913 GN=ACAN PE=1 SV=3
17	P55068	3.86e-95	328	883	0.128	0.191	PGCB_RAT Brevican core protein OS=Rattus norvegicus OX=10116 GN=Bcan PE=1 SV=2
18	Q96GW7	8.61e-94	325	911	0.129	0.188	PGCB_HUMAN Brevican core protein OS=Homo sapiens OX=9606 GN=BCAN PE=1 SV=2
19	F1QDA1	3.66e-93	333	1547	0.111	0.094	F1QDA1_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=2
20	Q61361	8.08e-92	319	883	0.124	0.186	PGCB_MOUSE Brevican core protein OS=Mus musculus OX=10090 GN=Bcan PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	4.9e-06	38.0	EGF-like domain
2	PF07974 EGF_2	4.7e+02	12.6	EGF-like domain
3	PF12661 hEGF	0.061	25.2	Human growth factor-like EGF
4	PF13927 Ig_3	81	15.2	Immunoglobulin domain
5	PF00059 Lectin_C	2.4e-21	87.8	Lectin C-type domain
6	PF00084 Sushi	3.3e-08	45.2	Sushi repeat (SCR repeat)
7	PF07686 V-set	1.6e-06	39.7	Immunoglobulin V-set domain
8	PF00193 Xlink	3.2e-58	205.3	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252575

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480132	0.987	Neural cell adhesion molecule 1
2	9606.ENSP00000344468	0.970	Syndecan-3
3	9606.ENSP00000264039	0.960	Glypican-1
4	9606.ENSP00000368678	0.952	Agrin
5	9606.ENSP00000243776	0.945	Chondroitin sulfate synthase 2
6	9606.ENSP00000292377	0.944	Glypican-2
7	9606.ENSP00000411816	0.944	Chondroitin sulfate N-acetylgalactosaminyltransferase 1
8	9606.ENSP00000359077	0.943	Neural cell adhesion molecule L1
9	9606.ENSP00000366267	0.941	Glypican-5
10	9606.ENSP00000362207	0.936	Carbohydrate sulfotransferase 3
11	9606.ENSP00000366246	0.936	Glypican-6
12	9606.ENSP00000305725	0.935	Carbohydrate sulfotransferase 11
13	9606.ENSP00000359864	0.934	Glypican-4
14	9606.ENSP00000261381	0.933	Xylosyltransferase 1
15	9606.ENSP00000433847	0.932	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1
16	9606.ENSP00000363827	0.931	Basement membrane-specific heparan sulfate proteoglycan core protein
17	9606.ENSP00000377836	0.927	Glypican-3
18	9606.ENSP00000370542	0.926	Syndecan-1
19	9606.ENSP00000307046	0.925	Syndecan-2
20	9606.ENSP00000361818	0.925	Syndecan-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.980	regulation of biological process
GO:0050794	0.966	regulation of cellular process
GO:0009987	0.862	cellular process
GO:0032501	0.554	multicellular organismal process
GO:0065008	0.546	regulation of biological quality
GO:0032502	0.530	developmental process
GO:0048856	0.503	anatomical structure development
GO:0007275	0.476	multicellular organism development
GO:0048731	0.420	system development
GO:0023051	0.410	regulation of signaling
GO:0010646	0.370	regulation of cell communication
GO:0050896	0.333	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0012505	0.996	endomembrane system
GO:0071944	0.995	cell periphery
GO:0005886	0.994	plasma membrane
GO:0070013	0.992	intracellular organelle lumen
GO:0005576	0.983	extracellular region
GO:0005794	0.980	Golgi apparatus
GO:0005796	0.894	Golgi lumen
GO:0005775	0.853	vacuolar lumen
GO:0043202	0.816	lysosomal lumen
GO:0030312	0.683	external encapsulating structure
GO:0062023	0.673	collagen-containing extracellular matrix
GO:0030054	0.415	cell junction
GO:0045202	0.349	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]