StarFunc result for job id O14595

User Input

>input (271 residues)
MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELA
AYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPI
NNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRC
GVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDM
ADTELLNLIPIFEELSGAEDVYTSLGQLRAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14595	1.000	1.000	7.752E-54	271	1.000	1.000	O14595.pdb.gz	CTDS2_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Homo sapiens OX=9606 GN=CTDSP2 PE=1 SV=2
2	AFDB:Q6P3I6	0.788	0.826	2.353E-42	258	0.727	0.764	Q6P3I6.pdb.gz	Q6P3I6_DANRE protein-serine/threonine phosphatase OS=Danio rerio OX=7955 GN=zgc:77714 PE=2 SV=1
3	AFDB:O15194	0.718	0.705	2.086E-36	276	0.664	0.652	O15194.pdb.gz	CTDSL_HUMAN CTD small phosphatase-like protein OS=Homo sapiens OX=9606 GN=CTDSPL PE=1 SV=2
4	AFDB:P58466	0.669	0.694	1.231E-35	261	0.572	0.594	P58466.pdb.gz	CTDS1_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Mus musculus OX=10090 GN=Ctdsp1 PE=1 SV=1
5	AFDB:M9PFN0	0.669	0.516	8.788E-35	352	0.524	0.403	M9PFN0.pdb.gz	HZG_DROME Phosphatase Herzog OS=Drosophila melanogaster OX=7227 GN=hzg PE=1 SV=1
6	AFDB:Q8T3G2	0.677	0.378	2.282E-31	491	0.506	0.279	Q8T3G2.pdb.gz	SCPL1_CAEEL CTD small phosphatase-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=scpl-1 PE=1 SV=2
7	AFDB:Q9XYL0	0.681	0.605	2.057E-29	306	0.491	0.435	Q9XYL0.pdb.gz	CTDS_DICDI Probable C-terminal domain small phosphatase OS=Dictyostelium discoideum OX=44689 GN=fcpA PE=3 SV=1
8	AFDB:Q07949	0.662	0.458	5.115E-27	397	0.421	0.287	Q07949.pdb.gz	PSR2_YEAST Probable phosphatase PSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR2 PE=1 SV=1
9	AFDB:Q07800	0.651	0.422	7.972E-27	427	0.402	0.255	Q07800.pdb.gz	PSR1_YEAST Phosphatase PSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR1 PE=1 SV=1
10	AFDB:Q5A7R0	0.671	0.417	2.155E-25	441	0.373	0.229	Q5A7R0.pdb.gz	Q5A7R0_CANAL Phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C300570CA PE=4 SV=1
11	PDB:2r8xH	0.285	0.383	7.019E-3	183	0.103	0.153	2r8xH.pdb.gz
12	PDB:1te2A	0.227	0.277	2.494E-2	218	0.066	0.083	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
13	PDB:5it0A	0.316	0.225	2.658E-2	396	0.100	0.068	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
14	PDB:7ef7A	0.283	0.319	3.888E-2	236	0.077	0.089	7ef7A.pdb.gz	Initiation of cytosolic plant purine nucleotide catabolism involves a monospecific xanthosine monophosphate phosphatase.
15	PDB:2b0cA	0.289	0.382	4.143E-2	199	0.077	0.106	2b0cA.pdb.gz	The 2.0A crystal structure of the putative phosphatase from Escherichia coli
16	PDB:3l5kA	0.268	0.305	5.338E-2	233	0.070	0.082	3l5kA.pdb.gz
17	PDB:2fueA	0.196	0.214	7.330E-2	246	0.055	0.061	2fueA.pdb.gz	The X-ray crystal structures of human alpha-phosphomannomutase 1 reveal the structural basis of congenital disorder of glycosylation type 1a.
18	PDB:3j09A	0.282	0.121	7.330E-2	723	0.070	0.026	3j09A.pdb.gz
19	PDB:4bbjA	0.282	0.129	9.445E-2	664	0.089	0.036	4bbjA.pdb.gz	Copper-Transporting P-Type Atpases Use a Unique Ion-Release Pathway
20	PDB:3ixzA	0.138	0.054	1.472E-1	998	0.074	0.020	3ixzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14595	0.0	561	271	1.000	1.000	CTDS2_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Homo sapiens OX=9606 GN=CTDSP2 PE=1 SV=2
2	Q8BX07	0.0	533	270	0.945	0.948	CTDS2_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Mus musculus OX=10090 GN=Ctdsp2 PE=2 SV=1
3	Q6P3I6	3.78e-140	396	258	0.727	0.764	Q6P3I6_DANRE protein-serine/threonine phosphatase OS=Danio rerio OX=7955 GN=zgc:77714 PE=2 SV=1
4	P58465	4.27e-115	333	276	0.649	0.638	CTDSL_MOUSE CTD small phosphatase-like protein OS=Mus musculus OX=10090 GN=Ctdspl PE=2 SV=3
5	O15194	4.83e-112	325	276	0.653	0.641	CTDSL_HUMAN CTD small phosphatase-like protein OS=Homo sapiens OX=9606 GN=CTDSPL PE=1 SV=2
6	Q9GZU7	5.63e-112	325	261	0.601	0.625	CTDS1_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
7	P58466	1.24e-110	322	261	0.598	0.621	CTDS1_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Mus musculus OX=10090 GN=Ctdsp1 PE=1 SV=1
8	H7C1Z7	3.91e-108	315	262	0.576	0.595	H7C1Z7_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
9	H7C270	3.74e-105	307	254	0.576	0.614	H7C270_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
10	M9PFN0	2.60e-98	293	352	0.528	0.406	HZG_DROME Phosphatase Herzog OS=Drosophila melanogaster OX=7227 GN=hzg PE=1 SV=1
11	Q8T3G2	5.71e-86	266	491	0.435	0.240	SCPL1_CAEEL CTD small phosphatase-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=scpl-1 PE=1 SV=2
12	Q07949	4.31e-69	220	397	0.373	0.254	PSR2_YEAST Probable phosphatase PSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR2 PE=1 SV=1
13	Q9XYL0	1.47e-68	216	306	0.362	0.320	CTDS_DICDI Probable C-terminal domain small phosphatase OS=Dictyostelium discoideum OX=44689 GN=fcpA PE=3 SV=1
14	Q07800	4.97e-68	218	427	0.380	0.241	PSR1_YEAST Phosphatase PSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR1 PE=1 SV=1
15	Q5A7R0	2.13e-64	209	441	0.347	0.213	Q5A7R0_CANAL Phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C300570CA PE=4 SV=1
16	Q9LYI7	5.74e-50	168	305	0.295	0.262	Q9LYI7_ARATH At5g11860 OS=Arabidopsis thaliana OX=3702 GN=SSP5 PE=1 SV=1
17	Q57ZA0	8.58e-46	160	423	0.299	0.191	Q57ZA0_TRYB2 FCP1 homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1170 PE=4 SV=1
18	Q05D32	1.31e-43	155	466	0.277	0.161	CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=2
19	Q8BG15	1.54e-43	155	465	0.277	0.161	CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus OX=10090 GN=Ctdspl2 PE=1 SV=1
20	I3L3K5	1.51e-40	141	208	0.266	0.346	I3L3K5_HUMAN CTD nuclear envelope phosphatase 1 (Fragment) OS=Homo sapiens OX=9606 GN=CTDNEP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03031 NIF	2.1e-49	178.8	NLI interacting factor-like phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020852

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005762	0.792	Cell division cycle associated 3
2	61853.ENSNLEP00000015776	0.693	Mothers against decapentaplegic homolog
3	61853.ENSNLEP00000010788	0.685	RE1-silencing transcription factor
4	61853.ENSNLEP00000013966	0.670	Mothers against decapentaplegic homolog
5	61853.ENSNLEP00000006702	0.658	Mothers against decapentaplegic homolog
6	61853.ENSNLEP00000000858	0.643	CTD nuclear envelope phosphatase 1 regulatory subunit 1
7	61853.ENSNLEP00000015171	0.638	NOP16 nucleolar protein
8	61853.ENSNLEP00000019300	0.620	General transcription factor IIF, polypeptide 1, 74kDa
9	61853.ENSNLEP00000007899	0.609	Lipin 3
10	61853.ENSNLEP00000008391	0.609	Lipin 2
11	61853.ENSNLEP00000017316	0.609	Lipin 1
12	61853.ENSNLEP00000000712	0.608	C-terminal binding protein 2
13	61853.ENSNLEP00000021415	0.608	Serine/threonine-protein phosphatase 2A activator
14	61853.ENSNLEP00000002579	0.603	Protein phosphatase 4, catalytic subunit
15	61853.ENSNLEP00000019952	0.601	Asporin
16	61853.ENSNLEP00000010252	0.582	Mothers against decapentaplegic homolog
17	61853.ENSNLEP00000011242	0.582	Translocase of inner mitochondrial membrane 21 homolog (yeast)
18	61853.ENSNLEP00000011022	0.581	Amelogenin, X-linked
19	61853.ENSNLEP00000009642	0.574	Translocase of inner mitochondrial membrane 17 homolog B (yeast)
20	61853.ENSNLEP00000021973	0.574	Mitochondrial import inner membrane translocase subunit TIM17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity
GO:0008420	0.460	RNA polymerase II CTD heptapeptide repeat phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0071704	0.981	organic substance metabolic process
GO:0065007	0.975	biological regulation
GO:0050794	0.968	regulation of cellular process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0044237	0.931	cellular metabolic process
GO:0080090	0.911	regulation of primary metabolic process
GO:0044238	0.860	primary metabolic process
GO:0043170	0.859	macromolecule metabolic process
GO:0048523	0.853	negative regulation of cellular process
GO:0060255	0.833	regulation of macromolecule metabolic process
GO:0010605	0.780	negative regulation of macromolecule metabolic process
GO:0051172	0.776	negative regulation of nitrogen compound metabolic process
GO:0045786	0.773	negative regulation of cell cycle
GO:0006807	0.771	nitrogen compound metabolic process
GO:1901987	0.739	regulation of cell cycle phase transition
GO:0043412	0.718	macromolecule modification
GO:0051248	0.696	negative regulation of protein metabolic process
GO:0051174	0.676	regulation of phosphorus metabolic process
GO:0031400	0.592	negative regulation of protein modification process
GO:0007346	0.579	regulation of mitotic cell cycle
GO:0010948	0.551	negative regulation of cell cycle process
GO:1901988	0.518	negative regulation of cell cycle phase transition
GO:0016311	0.509	dephosphorylation
GO:1901564	0.500	organonitrogen compound metabolic process
GO:0036211	0.481	protein modification process
GO:0010563	0.353	negative regulation of phosphorus metabolic process
GO:1902806	0.338	regulation of cell cycle G1/S phase transition
GO:1901990	0.317	regulation of mitotic cell cycle phase transition
GO:1901991	0.313	negative regulation of mitotic cell cycle phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]