StarFunc result for job id O14602

User Input

>input (144 residues)
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCH
IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
FGPGDDDEIQFDDIGDDDEDIDDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QK22	0.753	0.547	1.155E-24	200	0.951	0.685	A0A2R8QK22.pdb.gz
2	AFDB:Q9NJB4	0.747	0.728	4.236E-21	148	0.764	0.743	Q9NJB4.pdb.gz	Q9NJB4_DROME Eukaryotic translation initiation factor 4C OS=Drosophila melanogaster OX=7227 GN=eIF1A PE=2 SV=1
3	AFDB:P55877	0.750	0.781	2.159E-20	138	0.722	0.754	P55877.pdb.gz	IF1A_SCHPO Eukaryotic translation initiation factor 1A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif11 PE=2 SV=2
4	AFDB:Q9SJB9	0.729	0.724	4.580E-20	145	0.715	0.710	Q9SJB9.pdb.gz	Q9SJB9_ARATH Eukaryotic translation initiation factor 4C OS=Arabidopsis thaliana OX=3702 GN=At2g04520 PE=1 SV=1
5	AFDB:F4K1D3	0.776	0.746	8.569E-20	150	0.660	0.633	F4K1D3.pdb.gz	F4K1D3_ARATH Eukaryotic translation initiation factor 4C OS=Arabidopsis thaliana OX=3702 GN=MXH1.2 PE=1 SV=1
6	AFDB:I7MK25	0.730	0.551	3.194E-19	193	0.632	0.472	I7MK25.pdb.gz	I7MK25_TETTS Eukaryotic translation initiation factor 4C OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00497990 PE=1 SV=1
7	PDB:1d7qA	0.607	0.611	3.288E-19	143	0.986	0.993	1d7qA.pdb.gz	The eIF1A solution structure reveals a large RNA-binding surface important for scanning function.
8	AFDB:P38912	0.710	0.669	6.774E-19	153	0.660	0.621	P38912.pdb.gz	IF1A_YEAST Eukaryotic translation initiation factor 1A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF11 PE=1 SV=1
9	PDB:4btsA0	0.642	0.928	1.898E-14	99	0.451	0.657	4btsA0.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
10	PDB:6fyxi	0.695	0.820	2.765E-14	121	0.576	0.686	6fyxi.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
11	AFDB:Q57YI9	0.643	0.542	2.996E-11	172	0.382	0.320	Q57YI9.pdb.gz	Q57YI9_TRYB2 Eukaryotic translation initiation factor 1A, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.1060 PE=3 SV=1
12	PDB:6zxgj	0.547	0.668	5.008E-8	116	0.181	0.224	6zxgj.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
13	AFDB:Q23646	0.542	0.452	6.655E-8	175	0.167	0.137	Q23646.pdb.gz	EIF1A_CAEEL Probable RNA-binding protein EIF1AD OS=Caenorhabditis elegans OX=6239 GN=ZK856.11 PE=3 SV=1
14	AFDB:A0A024R5B9	0.552	0.486	1.032E-7	165	0.174	0.152	A0A024R5B9.pdb.gz
15	PDB:3i4oA	0.436	0.889	4.777E-7	68	0.118	0.250	3i4oA.pdb.gz
16	PDB:1zo1W	0.431	0.843	2.182E-5	71	0.097	0.197	1zo1W.pdb.gz
17	PDB:3kf6B	0.340	0.444	1.061E-3	105	0.104	0.143	3kf6B.pdb.gz
18	PDB:1ah9A	0.387	0.730	1.130E-3	71	0.125	0.254	1ah9A.pdb.gz
19	PDB:6epcJ	0.314	0.133	1.281E-3	406	0.069	0.025	6epcJ.pdb.gz	In Situ Structure of Neuronal C9orf72 Poly-GA Aggregates Reveals Proteasome Recruitment.
20	PDB:4v6wAX	0.311	0.312	1.364E-3	143	0.111	0.112	4v6wAX.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14602	4.43e-102	290	144	1.000	1.000	IF1AY_HUMAN Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AY PE=1 SV=4
2	P47813	5.90e-102	290	144	0.993	0.993	IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2
3	Q8BMJ3	5.90e-102	290	144	0.993	0.993	IF1AX_MOUSE Eukaryotic translation initiation factor 1A, X-chromosomal OS=Mus musculus OX=10090 GN=Eif1ax PE=2 SV=3
4	Q4V9N9	1.04e-101	289	144	0.986	0.986	Q4V9N9_DANRE Eukaryotic translation initiation factor 4C OS=Danio rerio OX=7955 GN=wu:fb38c07 PE=1 SV=1
5	Q6VV72	3.34e-101	288	144	0.979	0.979	IF1A_RAT Eukaryotic translation initiation factor 1A OS=Rattus norvegicus OX=10116 GN=Eif1a PE=2 SV=3
6	Q5XJR0	1.10e-97	279	144	0.958	0.958	Q5XJR0_DANRE Eukaryotic translation initiation factor 4C OS=Danio rerio OX=7955 GN=eif1ax PE=1 SV=1
7	Q9VEA1	1.15e-74	221	148	0.771	0.750	Q9VEA1_DROME Eukaryotic translation initiation factor 4C OS=Drosophila melanogaster OX=7227 GN=eIF1A PE=1 SV=1
8	Q9NJB4	3.65e-74	219	148	0.764	0.743	Q9NJB4_DROME Eukaryotic translation initiation factor 4C OS=Drosophila melanogaster OX=7227 GN=eIF1A PE=2 SV=1
9	P55877	1.34e-69	207	138	0.701	0.732	IF1A_SCHPO Eukaryotic translation initiation factor 1A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif11 PE=2 SV=2
10	Q9SJB9	9.79e-65	196	145	0.639	0.634	Q9SJB9_ARATH Eukaryotic translation initiation factor 4C OS=Arabidopsis thaliana OX=3702 GN=At2g04520 PE=1 SV=1
11	F4K1D3	2.10e-64	195	150	0.639	0.613	F4K1D3_ARATH Eukaryotic translation initiation factor 4C OS=Arabidopsis thaliana OX=3702 GN=MXH1.2 PE=1 SV=1
12	I7MK25	3.28e-54	171	193	0.576	0.430	I7MK25_TETTS Eukaryotic translation initiation factor 4C OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00497990 PE=1 SV=1
13	P38912	1.60e-51	162	153	0.528	0.497	IF1A_YEAST Eukaryotic translation initiation factor 1A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF11 PE=1 SV=1
14	Q57YI9	1.45e-19	81.6	172	0.340	0.285	Q57YI9_TRYB2 Eukaryotic translation initiation factor 1A, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.1060 PE=3 SV=1
15	E9PS76	2.37e-04	40.4	114	0.174	0.219	E9PS76_HUMAN Probable RNA-binding protein EIF1AD (Fragment) OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1
16	E9PLI6	2.96e-04	40.0	113	0.174	0.221	E9PLI6_HUMAN Probable RNA-binding protein EIF1AD (Fragment) OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1
17	Q8N9N8	3.32e-04	40.8	165	0.174	0.152	EIF1A_HUMAN Probable RNA-binding protein EIF1AD OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1
18	E9PS30	0.12	32.3	78	0.111	0.205	E9PS30_HUMAN Probable RNA-binding protein EIF1AD (Fragment) OS=Homo sapiens OX=9606 GN=EIF1AD PE=1 SV=1
19	P9WKK3	2.5	28.9	73	0.118	0.233	IF1_MYCTU Translation initiation factor IF-1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=infA PE=1 SV=1
20	Q99Q01	4.5	29.6	565	0.118	0.030	OSPD3_SHIFL Effector protease OspD3 OS=Shigella flexneri OX=623 GN=ospD3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01176 eIF-1a	3.4e-18	76.5	Translation initiation factor 1A / IF-1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000038797

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000005269	0.971	Eukaryotic translation initiation factor 3 subunit A
2	9598.ENSPTRP00000015627	0.961	Uncharacterized protein
3	9598.ENSPTRP00000035100	0.958	Eukaryotic translation initiation factor 3 subunit H
4	9598.ENSPTRP00000006664	0.956	40S ribosomal protein S30
5	9598.ENSPTRP00000017818	0.955	Eukaryotic translation initiation factor 3 subunit G
6	9598.ENSPTRP00000025478	0.954	Eukaryotic translation initiation factor 1B
7	9598.ENSPTRP00000013568	0.949	Eukaryotic translation initiation factor 3 subunit C
8	9598.ENSPTRP00000032202	0.949	Eukaryotic translation initiation factor 3 subunit B
9	9598.ENSPTRP00000035067	0.947	Eukaryotic translation initiation factor 3 subunit E
10	9598.ENSPTRP00000022998	0.946	Uncharacterized protein
11	9598.ENSPTRP00000005810	0.939	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
12	9598.ENSPTRP00000054742	0.924	Uncharacterized protein
13	9598.ENSPTRP00000029765	0.923	Ribosomal protein S14
14	9598.ENSPTRP00000061334	0.921	Ribosomal protein S28
15	9598.ENSPTRP00000038748	0.920	Pan troglodytes ribosomal protein S4, Y-linked 1 (RPS4Y1), mRNA
16	9598.ENSPTRP00000019932	0.918	Ribosomal protein S5
17	9598.ENSPTRP00000026978	0.918	Pan troglodytes ribosomal protein S3 (RPS3), mRNA
18	9598.ENSPTRP00000024650	0.916	Eukaryotic translation initiation factor 3 subunit D
19	9598.ENSPTRP00000018806	0.910	Ribosomal protein S16
20	9598.ENSPTRP00000029189	0.910	Ribosomal protein S23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003723	0.666	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0048856	0.989	anatomical structure development
GO:0032501	0.988	multicellular organismal process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0010468	0.987	regulation of gene expression
GO:2000112	0.975	regulation of cellular macromolecule biosynthetic process
GO:0060966	0.970	regulation of gene silencing by RNA
GO:0030218	0.969	erythrocyte differentiation
GO:0048821	0.960	erythrocyte development
GO:0048469	0.958	cell maturation
GO:0070920	0.958	regulation of production of small RNA involved in gene silencing by RNA
GO:0051246	0.942	regulation of protein metabolic process
GO:0071704	0.770	organic substance metabolic process
GO:0044238	0.759	primary metabolic process
GO:0043043	0.756	peptide biosynthetic process
GO:0006412	0.754	translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.990	cytosol
GO:0043229	0.945	intracellular organelle
GO:0043227	0.858	membrane-bounded organelle
GO:0043231	0.831	intracellular membrane-bounded organelle
GO:0005634	0.815	nucleus
GO:0070013	0.808	intracellular organelle lumen
GO:0031981	0.729	nuclear lumen
GO:0032991	0.637	protein-containing complex
GO:0005654	0.467	nucleoplasm
GO:0043232	0.341	intracellular non-membrane-bounded organelle
GO:0030054	0.324	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]