StarFunc result for job id O14603

User Input

>input (147 residues)
MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFL
WRYGKVGCISLPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQ
SFLLRTLERGRGFRALGDICGHVHEED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46187	0.189	0.177	2.632E-1	159	0.109	0.101	P46187.pdb.gz	RSEC_ECOLI Protein RseC OS=Escherichia coli (strain K12) OX=83333 GN=rseC PE=1 SV=1
2	PDB:4gwpF	0.109	0.084	9.561E-1	209	0.048	0.033	4gwpF.pdb.gz
3	AFDB:P47146	0.144	0.158	1.438	123	0.150	0.179	P47146.pdb.gz	ABM1_YEAST Aberrant microtubules protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABM1 PE=4 SV=1
4	PDB:6fhsE	0.156	0.069	1.581	441	0.095	0.032	6fhsE.pdb.gz	Structural basis for ATP-dependent chromatin remodelling by the INO80 complex.
5	PDB:3t24A	0.080	0.035	2.034	377	0.054	0.021	3t24A.pdb.gz	Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
6	PDB:6wjvA	0.143	0.018	2.166	1951	0.102	0.008	6wjvA.pdb.gz
7	AFDB:O94972	0.133	0.026	2.234	964	0.163	0.025	O94972.pdb.gz	TRI37_HUMAN E3 ubiquitin-protein ligase TRIM37 OS=Homo sapiens OX=9606 GN=TRIM37 PE=1 SV=2
8	AFDB:Q57YB5	0.129	0.029	2.234	1165	0.143	0.018	Q57YB5.pdb.gz	Q57YB5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.300 PE=1 SV=1
9	AFDB:Q8IZY2	0.150	0.020	2.234	2146	0.156	0.011	Q8IZY2.pdb.gz	ABCA7_HUMAN Phospholipid-transporting ATPase ABCA7 OS=Homo sapiens OX=9606 GN=ABCA7 PE=1 SV=3
10	PDB:6gejY	0.156	0.068	2.307	447	0.109	0.036	6gejY.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
11	AFDB:Q6F5E0	0.168	0.099	2.379	286	0.143	0.073	Q6F5E0.pdb.gz	TM158_MOUSE Transmembrane protein 158 OS=Mus musculus OX=10090 GN=Tmem158 PE=1 SV=1
12	AFDB:F8W0J4	0.139	0.124	2.534	173	0.109	0.092	F8W0J4.pdb.gz	F8W0J4_HUMAN YEATS domain containing 4 OS=Homo sapiens OX=9606 GN=YEATS4 PE=1 SV=1
13	AFDB:Q9XZT1	0.167	0.127	2.534	217	0.095	0.065	Q9XZT1.pdb.gz	MED18_DROME Mediator of RNA polymerase II transcription subunit 18 OS=Drosophila melanogaster OX=7227 GN=MED18 PE=1 SV=1
14	PDB:1k3eB	0.154	0.147	2.616	144	0.082	0.083	1k3eB.pdb.gz
15	PDB:3k8kA	0.109	0.030	2.616	650	0.061	0.014	3k8kA.pdb.gz	SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
16	PDB:6w17F	0.185	0.168	2.616	168	0.061	0.054	6w17F.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
17	PDB:5j6hA	0.208	0.133	2.786	275	0.143	0.076	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
18	PDB:6hiwDC	0.126	0.027	2.786	1095	0.122	0.016	6hiwDC.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	AFDB:Q7L0X0	0.191	0.044	3.258	811	0.109	0.020	Q7L0X0.pdb.gz	TRIL_HUMAN TLR4 interactor with leucine rich repeats OS=Homo sapiens OX=9606 GN=TRIL PE=1 SV=2
20	AFDB:Q9JMH2	0.155	0.050	3.695	623	0.122	0.029	Q9JMH2.pdb.gz	LRIT1_RAT Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Lrit1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14187	1.5	31.2	2363	0.088	0.006	SPP42_SCHPO Pre-mRNA-splicing factor spp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spp42 PE=1 SV=1
2	Q2XPU7	4.7	29.6	769	0.136	0.026	LUPS_RICCO Lupeol synthase OS=Ricinus communis OX=3988 PE=1 SV=1
3	Q9W2H2	7.7	28.9	751	0.109	0.021	Q9W2H2_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
4	Q9GYX3	7.8	28.9	751	0.109	0.021	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
5	P17751	9.2	28.5	249	0.082	0.048	TPIS_MOUSE Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1323663.AROI01000014_gene6

Rank	PPI partner	STRING score	Description
1	1323663.AROI01000023_gene1490	0.947	Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC- XerD complex is essential to convert dimers of the bacterial chromosome into monomers to permit their segregation at cell division. It also contributes to the segregational stability of plasmids.
2	1323663.AROI01000014_gene7	0.946	annotation not available
3	1323663.AROI01000016_gene469	0.925	The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing.
4	1323663.AROI01000016_gene470	0.922	The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing. RuvA stimulates, in the presence of DNA, the weak ATPase activity of RuvB.
5	1323663.AROI01000014_gene8	0.911	annotation not available
6	1323663.AROI01000013_gene206	0.907	The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. When the presence of a lesion has been verified by UvrB, the UvrA molecules dissociate
7	1323663.AROI01000026_gene1777	0.904	The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. Upon binding of the UvrA(2)B(2) complex to a putative damaged site, the DNA wraps around one UvrB monomer. DNA wrap is dependent on ATP binding by UvrB and probably causes local melting of the DNA helix, facilitating insertion of UvrB beta-hairpin between the DNA strands. Then UvrB probes one DNA strand for the presence of a lesion. If a lesion is found the UvrA subunits dissociate and the UvrB-DNA preincision [...]
8	1323663.AROI01000016_gene471	0.903	Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group
9	1323663.AROI01000010_gene3263	0.889	The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible for the 3' incision and the C-terminal half is responsible for the 5' incision
10	1323663.AROI01000002_gene1086	0.704	RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme.
11	1323663.AROI01000014_gene4	0.613	annotation not available
12	1323663.AROI01000014_gene5	0.586	annotation not available
13	1323663.AROI01000014_gene9	0.581	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.957	intracellular anatomical structure
GO:0043227	0.935	membrane-bounded organelle
GO:0043229	0.925	intracellular organelle
GO:0043231	0.915	intracellular membrane-bounded organelle
GO:0005737	0.913	cytoplasm
GO:0005739	0.555	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]